QSPIFLTPVFKEKIWGGTALRDRFGYSIPSESTGECWAISAHPKGPSTVANGPYKGKTLIELWEEHREVFGGVEGDRFPL
LTKLLDVKEDTSIKVHPDDYYAGENEEGELGKTECWYIIDCKENAEIIYGHTARSKTELVTMINSGDWEGLLRRIKIKPG
DFYYVPSGTLHALCKGALVLETQQNSDATYRVYDYDRLDSNGSPRELHFAKAVNAATVPHVDGYIDESTESRKGITIKTF
VQGEYFSVYKWDINGEAEMAQDESFLICSVIEGSGLLKYEDKTCPLKKGDHFILPAQMPDFTIKGTCTLIVSHI
The query sequence (length=314) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1qwr:A | 315 | 314 | 1.0000 | 0.9968 | 1.0000 | 0.0 | 1qwr:B |
2 | 1zx5:A | 300 | 314 | 0.2580 | 0.2700 | 0.2580 | 9.53e-16 | |
3 | 3h1m:A | 392 | 107 | 0.1083 | 0.0867 | 0.3178 | 0.005 | 3h1w:A, 3h1y:A, 5zvr:A, 5zvu:A, 5zvx:A |
4 | 3h1m:A | 392 | 161 | 0.1146 | 0.0918 | 0.2236 | 0.77 | 3h1w:A, 3h1y:A, 5zvr:A, 5zvu:A, 5zvx:A |
5 | 3nl1:A | 366 | 33 | 0.0382 | 0.0328 | 0.3636 | 1.2 | 4fag:A, 4fah:A, 4fbf:A, 3njz:A, 3nkt:A, 3nst:A, 3nvc:A, 3nw4:A, 2phd:A, 2phd:B, 2phd:C, 2phd:D |
6 | 2c5s:A | 372 | 179 | 0.1338 | 0.1129 | 0.2346 | 4.2 | |
7 | 2h0v:A | 335 | 20 | 0.0287 | 0.0269 | 0.4500 | 5.7 | 2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B |
8 | 6jt5:A | 409 | 87 | 0.0860 | 0.0660 | 0.3103 | 7.8 | 6jwf:A, 6jwf:B |
9 | 4bu2:A | 379 | 162 | 0.1115 | 0.0923 | 0.2160 | 8.5 |