QSLLRIETQLLLGRLLTRSGDQAWDFVVPFALLVIFPGKLQVAAFYYLIVKIGTFLLTVVKWGVWLQFFAILAGMVFFGM
LDGLVRAGGRESWLLSVLFIALALSGVMASLGSQITDISVSLVAPEKLTHFNSWLRRIDLATEVGAPILAGALFAFHPEQ
LPLAGLFLIGLWNLVSFVPEYFLLRNVISFSDPIFWLILSYALLWLSVLSPHGVLLAAYLKDEMRLPETEIGLFRGLGAV
FGLISTVSFPYLVRRLGLISSSRWHLGFQGVTLGIAVTAFAMGSTASVYVFLGCILLSRVGLYGFSNGEFELRQRLIPEG
RRGELNSLSSLTTTSATLILFSAGSLLPQTEDFKYLVYVSLAAVLLANVVFIKWSSR
The query sequence (length=377) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6btx:A | 377 | 377 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 5ayo:A | 406 | 406 | 0.9947 | 0.9236 | 0.9236 | 0.0 | 5aym:A |
3 | 8dl6:A | 442 | 436 | 0.2944 | 0.2511 | 0.2546 | 3.86e-19 | 8bzy:A, 8c03:A, 6vyh:A, 6wbv:A |
4 | 8dl7:A | 467 | 456 | 0.2944 | 0.2377 | 0.2434 | 1.39e-16 | 8dl8:A |
5 | 3bpt:A | 362 | 81 | 0.0743 | 0.0773 | 0.3457 | 3.3 | |
6 | 7oy2:C | 454 | 161 | 0.1088 | 0.0903 | 0.2547 | 4.0 | |
7 | 1p71:A | 94 | 49 | 0.0504 | 0.2021 | 0.3878 | 4.5 | 1p51:A, 1p51:B, 1p51:D, 1p51:C, 1p71:B, 1p78:A, 1p78:B |
8 | 5xm3:A | 596 | 69 | 0.0557 | 0.0352 | 0.3043 | 4.9 | 5xm3:C |
9 | 7ose:A | 503 | 161 | 0.1088 | 0.0815 | 0.2547 | 5.2 | 7ose:D |
10 | 6w1s:I | 1077 | 111 | 0.0769 | 0.0269 | 0.2613 | 7.2 | |
11 | 8izl:A | 2067 | 58 | 0.0424 | 0.0077 | 0.2759 | 9.5 | 8izm:A, 8x01:A, 8yxm:A, 8yxp:A |