QSFGLLDPKLCYLLDGILFIYGVILTALFLRVK
The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7phr:Z | 34 | 33 | 1.0000 | 0.9706 | 1.0000 | 4.46e-17 | 9ci8:b, 8es7:Y, 8es8:Y, 8es9:Y, 7fjd:a, 7fje:a, 7fjf:a, 8jc0:a, 8jcb:A, 8jcb:a, 8wy0:b, 8wyi:a |
2 | 7xlq:A | 1319 | 33 | 0.3939 | 0.0099 | 0.3939 | 2.4 | 8epl:A, 7yg5:A |
3 | 3pbk:A | 555 | 29 | 0.3939 | 0.0234 | 0.4483 | 3.8 | 3pbk:B |
4 | 9cpo:A | 930 | 19 | 0.3030 | 0.0108 | 0.5263 | 4.2 | |
5 | 8epm:A | 991 | 33 | 0.3939 | 0.0131 | 0.3939 | 6.8 | |
6 | 7mix:A | 1326 | 29 | 0.3636 | 0.0090 | 0.4138 | 7.2 | 7miy:A |
7 | 7fjg:A | 384 | 22 | 0.2121 | 0.0182 | 0.3182 | 7.5 | 8i29:A |
8 | 8x90:A | 1377 | 29 | 0.3636 | 0.0087 | 0.4138 | 7.9 | 8x91:A, 8x93:A |
9 | 7dlk:A | 363 | 15 | 0.2727 | 0.0248 | 0.6000 | 9.3 | 7dlk:B, 7dlk:C, 7dlk:D, 7dlk:E, 7dlk:F, 7e5q:A, 7e5q:B, 6kmm:A, 6kmm:B, 6kmm:C, 6kmm:D, 6kmm:E, 6kmm:F, 6kmn:A, 6kmn:B, 6kmn:C, 6kmn:D, 7pkx:A, 7pkx:B, 7pl0:A, 7pl0:B, 7pl0:C, 7pl0:D |
10 | 7vfs:A | 1266 | 29 | 0.3636 | 0.0095 | 0.4138 | 9.5 | 7vfu:A, 7vfv:A, 7vfw:A |