QRWRSDGRCGPNYPAPDANPGECNPHAVDHCCSEWGWCGRETSHCTCSSCVDYSAGSSGTCPRIVSKSEWGSRATNYNVF
LSLPVPKVVIHHSAGATCSTQSSCSLQVRNIQNYHMDGRGYSDIGYNFLVGNDGNVYEGRGWDRRGAHALNVNTESIGIC
FMGDFTSQKPTASAIAAAKSLISCGVSLGKIRSGYSLYGHRDVGSTACPGNLLYDDIKSWGRYV
The query sequence (length=224) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4z8i:A | 224 | 224 | 1.0000 | 1.0000 | 1.0000 | 4.35e-168 | |
2 | 3cg9:A | 171 | 165 | 0.3482 | 0.4561 | 0.4727 | 1.86e-50 | 6a89:B, 6a89:A, 6a89:D, 3cg9:B, 3cxa:A, 3cxa:B, 7dy5:C, 5e0b:C, 4fnn:A, 4fnn:B, 4fnn:D, 4gf9:D, 4gf9:C, 3ng4:C, 3ng4:D, 3nno:D, 3nw3:D, 3o4k:A, 3o4k:C, 3o4k:D, 3ogx:C, 3ogx:A, 4opp:A, 4opp:B, 4opp:D, 4opp:C, 4orv:D, 4oug:C, 4oug:D, 4q8s:A, 4q8s:C, 4q8s:D, 4q9e:D, 3qv4:C, 3rt4:C, 3rt4:D, 3t2v:B, 3t2v:D, 3t39:D, 3tru:D, 3usx:B, 7xfw:C, 7xfx:C, 7xfy:C, 7xfy:D, 7xu8:A, 7xu8:B |
3 | 2aph:A | 165 | 164 | 0.3170 | 0.4303 | 0.4329 | 1.24e-46 | 2aph:B, 1sk4:A, 1twq:A |
4 | 2f2l:X | 166 | 158 | 0.3259 | 0.4398 | 0.4620 | 5.58e-46 | |
5 | 2eax:C | 164 | 163 | 0.3125 | 0.4268 | 0.4294 | 5.89e-42 | |
6 | 1oht:A | 173 | 162 | 0.2991 | 0.3873 | 0.4136 | 3.28e-41 | 7nsx:AAA, 7nsz:AAA, 7nt0:AAA, 7nt0:BBB |
7 | 2xz4:A | 165 | 161 | 0.2812 | 0.3818 | 0.3913 | 4.31e-41 | |
8 | 2cb3:C | 173 | 161 | 0.2902 | 0.3757 | 0.4037 | 2.15e-38 | 2cb3:A, 2cb3:B, 2cb3:D |
9 | 2f2l:A | 167 | 162 | 0.2455 | 0.3293 | 0.3395 | 1.61e-28 | |
10 | 6srt:A | 152 | 160 | 0.2054 | 0.3026 | 0.2875 | 1.28e-13 | 6ssc:A |
11 | 1lba:A | 146 | 124 | 0.1830 | 0.2808 | 0.3306 | 5.68e-13 | |
12 | 6fhg:A | 156 | 154 | 0.1964 | 0.2821 | 0.2857 | 2.48e-12 | 6fhg:B |
13 | 6su5:A | 154 | 134 | 0.1741 | 0.2532 | 0.2910 | 8.15e-11 | |
14 | 7f5i:A | 153 | 102 | 0.1652 | 0.2418 | 0.3627 | 7.53e-10 | |
15 | 3vth:A | 753 | 67 | 0.0982 | 0.0292 | 0.3284 | 1.3 | 3vth:B, 3vti:A, 3vti:B |
16 | 6ygd:B | 720 | 93 | 0.1161 | 0.0361 | 0.2796 | 1.8 | |
17 | 4wp4:A | 43 | 16 | 0.0402 | 0.2093 | 0.5625 | 2.3 | |
18 | 6lnr:A | 292 | 21 | 0.0446 | 0.0342 | 0.4762 | 6.5 | |
19 | 6sto:A | 165 | 137 | 0.1652 | 0.2242 | 0.2701 | 7.2 | 6sto:B, 6stp:A, 6stp:B |
20 | 4o5o:B | 261 | 33 | 0.0580 | 0.0498 | 0.3939 | 7.5 | 4o5o:A |
21 | 7aqr:P | 332 | 40 | 0.0759 | 0.0512 | 0.4250 | 8.5 | 7a23:T, 7a24:T, 7ar7:P, 7ar8:P, 7arb:P, 8bee:P, 8bpx:P, 8bq5:P, 8bq6:P |