QQVCPNYVMLRSSVTTKVVRNVVEYQIRTGGFFSCLAMLRPLQYAKRERLLGQRNLERISTRDILQTRDLHSLCMPTPDA
PMSNHQASTMRELICSYFKVDHADGLKYIPMDERYSPSSLARLFTMGMAGLHITTEPSYKRVPIMHLAADLDCMTLALPY
MITLDGDTVVPVAPTLSAEQLLDDGLKGLACMDISYGCESSRCINELYCEETAEAICVLKTCLVLNCMQFKLEMDDLAHN
AAELDKIQMMIPFSERVFRMASSFATIDAQCFRFCVMMKDKNLKIDMRETTRLWTRSASDDSVATSSLSISLDRGRWVAA
DASDARLLVFPIRV
The query sequence (length=334) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8tl1:A | 336 | 336 | 1.0000 | 0.9940 | 0.9940 | 0.0 | 8tl8:A, 8tl8:B |
2 | 3i6d:B | 419 | 46 | 0.0449 | 0.0358 | 0.3261 | 1.2 | 3i6d:A |
3 | 5hab:B | 463 | 89 | 0.0629 | 0.0454 | 0.2360 | 2.2 | 5haa:A, 5haa:B, 5hab:A, 6llb:A, 6llb:B, 5ws2:A, 5ws2:B |
4 | 8acs:A | 598 | 42 | 0.0389 | 0.0217 | 0.3095 | 3.4 | 8acs:B, 8acs:C, 8acs:D |
5 | 5dor:B | 161 | 85 | 0.0689 | 0.1429 | 0.2706 | 3.9 | |
6 | 5b1j:C | 124 | 34 | 0.0269 | 0.0726 | 0.2647 | 7.6 | 3ef4:A, 3ef4:B, 3ef4:C |
7 | 7o4f:A | 136 | 47 | 0.0479 | 0.1176 | 0.3404 | 7.9 | 7o4e:A, 7o4e:B, 7o4f:B, 7o4f:D, 7o4f:G |
8 | 3it3:A | 337 | 46 | 0.0509 | 0.0504 | 0.3696 | 7.9 | 4e3w:A, 4e3w:B, 3it0:A, 3it0:B, 3it3:B |