QPIIQFDAESWEAEFTQEIQDKAIEGLESGSVLFFPKLNFPLLTEELKFLDPTWVSGAKNISYDPRSATLKGVEGKSEDL
RLLSGLLKRYAEKTAAFLHLLFPFYGSSLKIARTSFRPVEISGRATSARKDDTRLHVDAFPSSPTGGERILRVFSNINPQ
GKPRSWRIGEPFQNYLNHLLPQLSPPAPGKRFLLYLFGITKGYRSLYDHYMLELHDKGKLDLEYQKNSPQVAFDFPAGST
WIVFTDQVLHAVDKGQFLLEQTFHLKVNALKHPEKSPLKLLETALNKKLVSSESFKLA
The query sequence (length=298) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5y9x:A | 298 | 298 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5y9i:A, 5y9y:A, 5yka:A, 5yvz:A, 5yw0:A |
2 | 1i3k:A | 347 | 49 | 0.0705 | 0.0605 | 0.4286 | 0.10 | 1ek5:A, 1ek6:A, 1ek6:B, 1hzj:A, 1hzj:B, 1i3k:B, 1i3l:A, 1i3l:B, 1i3m:A, 1i3m:B, 1i3n:A, 1i3n:B |
3 | 1a9y:A | 338 | 94 | 0.0973 | 0.0858 | 0.3085 | 0.22 | 1a9z:A, 5gy7:A, 5gy7:B, 1kvq:A, 1kvr:A, 1kvs:A, 1kvt:A, 1kvu:A, 1lrj:A, 1lrk:A, 1lrl:A, 1nah:A, 1nai:A, 1uda:A, 1udb:A, 1udc:A, 2udp:A, 2udp:B, 1xel:A |
4 | 1z45:A | 674 | 48 | 0.0705 | 0.0312 | 0.4375 | 0.91 | |
5 | 4lis:A | 364 | 101 | 0.1107 | 0.0907 | 0.3267 | 1.2 | 4lis:B, 4lis:C |
6 | 8fac:A | 1377 | 60 | 0.0705 | 0.0153 | 0.3500 | 1.6 | 8e04:A |
7 | 2cw6:A | 296 | 27 | 0.0369 | 0.0372 | 0.4074 | 2.7 | 2cw6:B, 2cw6:C, 2cw6:D, 2cw6:E, 2cw6:F, 3mp3:A, 3mp3:B, 3mp3:C, 3mp3:D, 3mp3:E, 3mp3:F, 3mp5:B, 3mp5:C |
8 | 6ig2:D | 278 | 67 | 0.0705 | 0.0755 | 0.3134 | 4.2 | 6ig4:A, 6ig4:B |
9 | 3dbx:A | 279 | 46 | 0.0470 | 0.0502 | 0.3043 | 4.4 | |
10 | 1gd9:A | 388 | 148 | 0.1376 | 0.1057 | 0.2770 | 4.5 | 1dju:A, 1dju:B, 1gd9:B, 1gde:A, 1gde:B |
11 | 6ui4:A | 692 | 56 | 0.0604 | 0.0260 | 0.3214 | 4.7 | |
12 | 3q13:A | 236 | 76 | 0.0638 | 0.0805 | 0.2500 | 5.1 | |
13 | 8bn5:B | 267 | 30 | 0.0436 | 0.0487 | 0.4333 | 6.4 | 8blj:A, 8blj:B, 8blj:C, 8blj:D, 8blj:E, 8blj:F, 8bn2:A, 8bn2:B, 8bn5:A |
14 | 8wov:B | 341 | 71 | 0.0805 | 0.0704 | 0.3380 | 7.6 | 8wop:A, 8wop:B, 8wov:A, 8wow:A, 8wow:B |
15 | 2v6i:A | 421 | 40 | 0.0470 | 0.0333 | 0.3500 | 7.7 | |
16 | 6jp4:A | 770 | 125 | 0.1174 | 0.0455 | 0.2800 | 8.4 | 6jp4:B, 6jp4:C, 6jph:A, 6jpn:A |