QLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEG
RAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKAS
GAWVLDSISHFK
The query sequence (length=172) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7uml:C | 172 | 172 | 1.0000 | 1.0000 | 1.0000 | 1.21e-130 | 7uml:B |
2 | 7xt2:B | 388 | 50 | 0.1047 | 0.0464 | 0.3600 | 1.6 | 7xt2:A |
3 | 3c3d:A | 306 | 61 | 0.0988 | 0.0556 | 0.2787 | 2.7 | 3c3d:B, 3c3d:C, 3c3d:D, 3c3e:A, 3c3e:B, 3c3e:C, 3c3e:D |
4 | 1f5j:B | 199 | 52 | 0.0930 | 0.0804 | 0.3077 | 4.2 | |
5 | 8ht4:B | 390 | 28 | 0.0581 | 0.0256 | 0.3571 | 5.2 | 8ht4:A |
6 | 1j04:A | 387 | 79 | 0.1221 | 0.0543 | 0.2658 | 6.9 | 4cbr:A, 4cbs:A, 5f9s:A, 5f9s:B, 1h0c:A, 5hhy:A, 5hhy:B, 5luc:A, 5luc:B, 5luc:E, 5luc:G, 5luc:M, 5luc:N, 5luc:S, 5luc:T, 5ofy:A, 5og0:A, 6rv0:A, 6rv1:A, 2yob:A, 2yob:B |