BioLiP

>protein
QLRRIREHPCFSEKACHAFGRMHLPVAPKCNIQCKYCIRDFDCVNESRPGVTSRVLTPQEALERVDEVLSKYHYIKVVAV
AGPGEPLANEETFETLRLVGEKYPHLILCISTNGLLLPDRIEDLDRIGVTNITVTLNAVDPTIGEQIYDYVIYKGERYEG
LEAAKILLDNQLKGIEEAVRRKKIVKVNTVLIPGINDKHVFDIARKIKSMGVFIHNVMPLIPQYKFAHIKPPTPEEKRAI
QDELSKIIKQMR

The query sequence (length=252) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y1x:A	252	252	1.0000	1.0000	1.0000	0.0	6y1x:B
2	7bi7:A	279	248	0.4881	0.4409	0.4960	2.42e-83	7bi7:B, 7jmb:A, 7jmb:B
3	7vob:C	327	218	0.2262	0.1743	0.2615	8.30e-07	7voc:C
4	2fb2:A	327	190	0.1984	0.1529	0.2632	5.39e-06	2fb2:B, 2fb3:A, 2fb3:B, 1tv7:A, 1tv7:B, 1tv8:A, 1tv8:B
5	5cy7:A	171	65	0.0833	0.1228	0.3231	0.004	5cp0:A, 5cpd:A, 5cvk:A, 5cvp:A, 5cvq:A, 5cwx:A, 5cwy:A, 5cx0:A, 5cxj:A, 5cy8:A, 6ikt:A, 6iky:A, 6il0:A, 6il2:A, 4nt8:A
6	4m7s:A	214	121	0.1111	0.1308	0.2314	1.0
7	4k36:A	381	101	0.1230	0.0814	0.3069	1.1	4k36:B, 4k37:A, 4k37:B, 4k38:B, 4k38:A, 4k39:B, 4k39:A
8	7ane:aj	316	42	0.0635	0.0506	0.3810	1.5
9	2i9u:A	419	60	0.0675	0.0406	0.2833	1.9	2i9u:B
10	5why:A	418	118	0.1071	0.0646	0.2288	2.1
11	4m7t:A	246	132	0.1230	0.1260	0.2348	2.1
12	7aor:aj	315	36	0.0675	0.0540	0.4722	2.5
13	5wgg:A	440	105	0.0913	0.0523	0.2190	3.2	5why:B
14	8uyh:A	375	36	0.0556	0.0373	0.3889	6.2	8uyh:B, 8uyi:A, 8uyi:B
15	8b9d:4	677	120	0.1190	0.0443	0.2500	9.3	7pfo:4, 7plo:4

[Back]