BioLiP

>protein
QLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKY
ARENEHPLLCTLEKA

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3o2b:C	105	95	1.0000	0.9048	1.0000	1.86e-67	1mbx:D, 3o2b:A, 3o2h:A, 1r6o:D, 1r6q:D, 2w9r:A, 2wa8:A, 2wa8:C, 2wa9:A, 2wa9:B, 2wa9:C, 2wa9:D, 2wa9:E, 2wa9:F, 2wa9:G
2	3gq1:A	85	83	0.5053	0.5647	0.5783	3.26e-32	3dnj:A, 3dnj:B, 3g19:A, 3g1b:A, 3g1b:B, 3g3p:B, 3gq1:B, 3gw1:A, 3gw1:B
3	4yjx:C	84	80	0.3263	0.3690	0.3875	2.57e-14	4yjx:A, 4yjx:B, 4yjx:D, 4yka:A, 4yka:B, 4yka:C, 4yka:D
4	7d34:A	79	52	0.2105	0.2532	0.3846	2.55e-04
5	7vx0:B	680	61	0.2000	0.0279	0.3115	1.8	7vx0:A, 7vyj:A, 7vyj:B, 7vyo:A, 7vyo:B, 7vyp:A, 7vyp:B, 7vzn:A, 7vzn:B, 7vzq:A, 7vzq:B, 7vzu:A, 7vzu:B, 7vzy:A, 7vzy:B, 7vzz:A, 7vzz:B
6	8jev:A	556	32	0.1158	0.0198	0.3438	2.7	8jev:B
7	3tto:A	1055	37	0.1263	0.0114	0.3243	5.1	3tto:B, 3tto:C, 3tto:D, 3ttq:A, 4ttu:A, 4tvc:A, 4tvd:A
8	8jgj:A	684	15	0.0842	0.0117	0.5333	5.3	8jgj:B, 8jgk:A, 8jgk:B, 8jgl:A, 8jgl:B, 8jgv:A, 8jgv:B
9	4x0o:E	360	24	0.1158	0.0306	0.4583	5.8	5kp2:B, 5v0p:A, 5v0p:B, 4x0o:A, 4x0o:B, 4x0o:D, 4x0o:F, 4x0o:G, 4x0o:H

[Back]