QKVLFPTERLSLRWERVFRVGAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFAN
SGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVCKS
VSDTYDPYLDVALEIRQAANIVRALELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKIT
KDVGYPEFLNIRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY
LRIP
The query sequence (length=324) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8bs3:A | 324 | 324 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8bs9:A, 8bs9:C |
2 | 3mhs:A | 455 | 316 | 0.3056 | 0.2176 | 0.3133 | 1.24e-44 | 6aqr:A, 4fip:A, 4fip:E, 4fjc:A, 4fk5:A, 6t9l:K, 4w4u:A, 4wa6:A, 4zux:U, 4zux:Z, 4zux:e, 4zux:j |
3 | 2hd5:A | 315 | 313 | 0.3117 | 0.3206 | 0.3227 | 1.44e-42 | |
4 | 3nhe:A | 338 | 332 | 0.3241 | 0.3107 | 0.3163 | 2.88e-42 | 6dgf:A, 2ibi:A, 3v6c:A, 3v6e:A, 5xu8:A, 5xve:A |
5 | 4fjc:E | 434 | 305 | 0.3056 | 0.2281 | 0.3246 | 1.23e-41 | 3m99:A, 3mhh:A |
6 | 2y5b:E | 325 | 327 | 0.3179 | 0.3169 | 0.3150 | 4.09e-39 | 3i3t:A, 3i3t:C, 3i3t:E, 3i3t:G, 3mtn:A, 3mtn:C, 2y5b:A |
7 | 2y6e:B | 339 | 328 | 0.2901 | 0.2773 | 0.2866 | 1.09e-37 | 2y6e:A, 2y6e:C, 2y6e:E, 2y6e:F |
8 | 7r2g:B | 351 | 332 | 0.2932 | 0.2707 | 0.2861 | 1.30e-35 | 6cpm:C, 6cpm:D, 6crn:A, 6crn:B, 6crn:C, 6crn:D, 6gh9:A, 6gha:A, 6ml1:A, 6ml1:B, 7r2g:A |
9 | 4wa6:D | 415 | 309 | 0.2778 | 0.2169 | 0.2913 | 3.61e-35 | 4w4u:D |
10 | 5k16:B | 328 | 314 | 0.2809 | 0.2774 | 0.2898 | 4.50e-35 | 5cvm:A, 5k16:A, 5k1c:A, 5l8h:A, 5l8w:A |
11 | 5cvn:B | 321 | 317 | 0.2840 | 0.2866 | 0.2902 | 4.64e-34 | 5cvo:B, 5cvo:E, 6jlq:A |
12 | 5wch:A | 350 | 296 | 0.2685 | 0.2486 | 0.2939 | 1.41e-30 | 5wch:B, 5wch:C, 5wch:D |
13 | 5k1b:A | 264 | 306 | 0.2685 | 0.3295 | 0.2843 | 3.01e-30 | |
14 | 9fcj:D | 312 | 323 | 0.2531 | 0.2628 | 0.2539 | 9.65e-29 | 7ay0:B, 9fci:D |
15 | 7ay1:D | 341 | 341 | 0.2623 | 0.2493 | 0.2493 | 2.20e-28 | 8a9j:D, 7ay2:B, 7zh3:D |
16 | 8a9k:D | 285 | 312 | 0.2469 | 0.2807 | 0.2564 | 8.68e-28 | 7ay0:D, 7zh4:D |
17 | 3n3k:A | 355 | 338 | 0.2809 | 0.2563 | 0.2692 | 2.03e-25 | 2gfo:A, 8xpn:A, 8xpn:B |
18 | 7w3u:A | 343 | 293 | 0.2284 | 0.2157 | 0.2526 | 2.53e-25 | 7w3r:A, 7w3u:B, 7w3u:C |
19 | 8itn:A | 350 | 340 | 0.2685 | 0.2486 | 0.2559 | 1.73e-24 | 8itn:C, 8itp:D, 8itp:B |
20 | 5txk:A | 317 | 320 | 0.2901 | 0.2965 | 0.2938 | 1.18e-22 | |
21 | 5n9t:A | 357 | 324 | 0.2593 | 0.2353 | 0.2593 | 3.56e-21 | 8d4z:A, 8d4z:B, 6f5h:A, 6f5h:B, 6m1k:A, 6m1k:B, 5n9r:A, 5n9r:B, 5n9t:B, 5nge:A, 5ngf:A, 5ngf:B, 5uqv:A, 5uqv:B, 5uqx:A, 5uqx:B, 6vn2:A, 6vn2:B, 6vn3:A, 6vn3:B, 6vn4:A, 6vn4:B, 6vn5:A, 6vn5:B, 6vn6:A, 6vn6:B, 5vs6:A, 5vs6:B, 5vsb:A, 5vsb:B, 5vsk:A, 5whc:A, 5whc:B, 7xhh:A, 7xhh:B, 7xhk:B |
22 | 5k1a:A | 239 | 303 | 0.2438 | 0.3305 | 0.2607 | 9.19e-21 | 5k1a:C, 5k1a:E, 5k1a:G |
23 | 8xpn:C | 327 | 329 | 0.2716 | 0.2691 | 0.2675 | 2.08e-19 | |
24 | 5ohk:A | 304 | 314 | 0.2346 | 0.2500 | 0.2420 | 1.12e-17 | 5ohn:A, 5ohn:C |
25 | 5gvi:A | 326 | 334 | 0.2377 | 0.2362 | 0.2305 | 5.66e-16 | |
26 | 6iil:A | 341 | 355 | 0.2562 | 0.2434 | 0.2338 | 2.36e-14 | 6iik:A, 6iik:B, 6iil:B, 6iim:A, 6iim:B, 6iin:A, 6iin:B |
27 | 8d1t:A | 330 | 331 | 0.2284 | 0.2242 | 0.2236 | 9.16e-14 | 8d0a:A, 5ohp:A |
28 | 8p14:A | 331 | 330 | 0.2716 | 0.2659 | 0.2667 | 2.04e-12 | 8hje:A, 7tuo:A |
29 | 5nge:B | 313 | 320 | 0.2438 | 0.2524 | 0.2469 | 2.38e-12 | 5vsk:B |
30 | 5cht:A | 308 | 294 | 0.2253 | 0.2370 | 0.2483 | 8.85e-11 | 5cht:B, 5chv:A, 5chv:B |
31 | 7ay2:E | 203 | 170 | 0.1173 | 0.1872 | 0.2235 | 2.66e-09 | |
32 | 8y6o:U | 458 | 339 | 0.2346 | 0.1659 | 0.2242 | 2.26e-07 | 8h6e:4T, 8h6j:4T, 6qw6:U, 6qx9:U |
33 | 6h4h:A | 458 | 255 | 0.1975 | 0.1397 | 0.2510 | 1.41e-05 | 6h4h:B, 8p1p:A |
34 | 6h4h:A | 458 | 74 | 0.0864 | 0.0611 | 0.3784 | 0.018 | 6h4h:B, 8p1p:A |
35 | 3ihp:B | 681 | 144 | 0.1019 | 0.0485 | 0.2292 | 7.61e-05 | 6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A |
36 | 3ihp:B | 681 | 62 | 0.0679 | 0.0323 | 0.3548 | 0.002 | 6dxh:A, 6dxt:A, 6dxt:B, 2g43:A, 2g43:B, 2g45:A, 2g45:D, 3ihp:A, 7ms5:A, 7ms5:B, 7ms6:A, 7ms7:A, 7ms7:B, 6nft:A, 6nft:B, 6p9g:A |
37 | 8p1q:A | 439 | 250 | 0.1821 | 0.1344 | 0.2360 | 0.002 | 8p1p:B, 8p1q:B |
38 | 8p1q:A | 439 | 74 | 0.0864 | 0.0638 | 0.3784 | 0.019 | 8p1p:B, 8p1q:B |
39 | 6k0w:B | 499 | 144 | 0.1019 | 0.0661 | 0.2292 | 0.22 | |
40 | 6k0w:A | 528 | 144 | 0.1019 | 0.0625 | 0.2292 | 0.26 | |
41 | 2ysv:A | 42 | 25 | 0.0340 | 0.2619 | 0.4400 | 1.6 | |
42 | 7w5w:J | 107 | 68 | 0.0586 | 0.1776 | 0.2794 | 2.2 | 7w5x:K, 7w5y:K |
43 | 8c61:J | 330 | 139 | 0.1049 | 0.1030 | 0.2446 | 2.6 | 8c61:A, 8c61:D, 8c61:G |
44 | 4tlx:A | 415 | 92 | 0.0772 | 0.0602 | 0.2717 | 2.8 | 4tlx:B, 4tlx:C, 4tlx:D, 4tlz:A, 4tlz:B, 4tlz:C, 4tlz:D, 4tm0:A, 4tm0:B, 4tm0:C, 4tm0:D, 4tm1:A, 4tm1:B, 4tm1:C, 4tm1:D, 4tm3:A, 4tm3:B, 4tm3:C, 4tm3:D, 4tm4:A, 4tm4:B, 4tm4:C, 4tm4:D |
45 | 3a7a:A | 337 | 37 | 0.0432 | 0.0415 | 0.3784 | 4.1 | 3a7a:C, 3a7r:A, 4tvw:A, 4tvw:B, 4tvw:C, 4tvw:D, 4tvy:A, 4tvy:B, 1x2h:A, 1x2h:B |
46 | 2yte:A | 42 | 25 | 0.0309 | 0.2381 | 0.4000 | 4.2 |