QISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQE
EFENAAHVRDQIRLLEQSL
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8wtc:B | 100 | 99 | 1.0000 | 0.9900 | 1.0000 | 4.05e-71 | 8wtb:B, 8wtb:D, 8wtc:D |
2 | 8gqd:E | 59 | 49 | 0.2222 | 0.3729 | 0.4490 | 5.20e-12 | |
3 | 5fks:A | 731 | 35 | 0.1414 | 0.0192 | 0.4000 | 0.34 | |
4 | 7odf:A | 703 | 32 | 0.1010 | 0.0142 | 0.3125 | 0.39 | |
5 | 5b4x:B | 479 | 59 | 0.1919 | 0.0397 | 0.3220 | 0.55 | 3a7q:B, 5b4x:D, 5b4y:B |
6 | 4ayg:A | 1028 | 46 | 0.1515 | 0.0146 | 0.3261 | 1.2 | 4ayg:B, 3hz3:A, 3klk:A, 3kll:A |
7 | 7drc:C | 906 | 41 | 0.1515 | 0.0166 | 0.3659 | 2.6 | 7drb:C, 7drb:D, 7w3v:C, 7w3x:C |
8 | 7rbx:C | 425 | 39 | 0.1313 | 0.0306 | 0.3333 | 3.1 | 7rbx:A, 7rbx:B, 7rbx:D |
9 | 2i13:A | 151 | 60 | 0.1616 | 0.1060 | 0.2667 | 4.8 | |
10 | 6lt4:A | 623 | 38 | 0.1212 | 0.0193 | 0.3158 | 5.2 | 6lt4:B, 6lt4:C, 6lt4:D, 6lt4:E, 6lt4:F, 6lt4:G, 6lt4:H, 6lt4:I, 6lt4:J, 6lt4:K, 6lt4:L, 6lt4:M, 6lt4:N |
11 | 5z8l:A | 204 | 22 | 0.1010 | 0.0490 | 0.4545 | 6.3 | 5z8n:A, 5z8n:B, 5z8n:C |
12 | 3u44:A | 1122 | 21 | 0.0909 | 0.0080 | 0.4286 | 7.1 | 3u4q:A |
13 | 6ra9:B | 458 | 49 | 0.1414 | 0.0306 | 0.2857 | 7.3 | 8b6z:A, 4c0s:A, 4c0s:B, 8g5z:EF, 8g60:EF, 8g6j:EF, 5lzs:jj, 6ra9:A, 6zmo:CD |
14 | 4cej:A | 1177 | 21 | 0.0909 | 0.0076 | 0.4286 | 7.8 | 4ceh:A, 4cei:A |
15 | 9asj:A | 741 | 33 | 0.1212 | 0.0162 | 0.3636 | 8.0 | 9asj:B, 9bp9:A, 9bp9:C, 9bpa:A, 9bpa:C, 9bpa:E, 9bpa:G |
16 | 8uw3:A | 1265 | 50 | 0.1717 | 0.0134 | 0.3400 | 8.6 | 7n8s:A, 7n94:A, 7n94:B, 8sp5:A, 8sp5:B, 8sp7:A, 8sxt:A, 8sxu:A, 1vyb:B |