QIEIEWVQPGITVTADLSWERNPELAELLWTGLLPYNSLQNHALVSGNHLYHLIADPRLVYTEARYKEDRTKSPDGTVFL
SQLQHLAVKYGPLTEYLPAAPVGSVVPEDIDALREAGRACWKAAWETKQPIEVRVRRKGEAVTDFALPRTPPVDHPGVQK
LVEEIQDETERVWITPPAEIVDMHQGRIASRAGSYDQYFSTLVFLNGEVRPLGYCALNGLLKICRTTDLTLNDLKRITPT
FIKTPAEFLGYTGLDTLWRFTQQVLTLLPDVETREQYFALVNALALYANMLNTWNLHFFPWQHGTDYRY
The query sequence (length=309) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3x27:D | 314 | 309 | 1.0000 | 0.9841 | 1.0000 | 0.0 | 3x27:A, 3x27:B, 3x27:C |
2 | 6hiv:CH | 273 | 72 | 0.0680 | 0.0769 | 0.2917 | 0.13 | 6hiw:CH, 6hiy:CH, 7pub:CH |
3 | 5zq6:A | 828 | 83 | 0.0874 | 0.0326 | 0.3253 | 2.5 | 5zq4:B, 5zq4:A, 5zq6:C, 5zq7:A, 5zq7:C |
4 | 7ttj:A | 643 | 68 | 0.0712 | 0.0342 | 0.3235 | 2.7 | 7ttl:B, 3v99:A |
5 | 3v99:B | 639 | 68 | 0.0712 | 0.0344 | 0.3235 | 2.8 | |
6 | 6ncf:B | 676 | 68 | 0.0712 | 0.0325 | 0.3235 | 2.8 | 6ncf:A, 6ncf:C, 6ncf:D, 3o8y:A, 3o8y:B, 7ttk:A, 7ttk:B, 7ttl:A, 7ttl:D, 3v92:B, 3v92:A, 3v98:A, 3v98:B |
7 | 7ttl:C | 617 | 68 | 0.0712 | 0.0357 | 0.3235 | 3.1 | 6n2w:A, 6n2w:B |
8 | 4d1j:D | 540 | 60 | 0.0615 | 0.0352 | 0.3167 | 6.6 | 4d1j:A, 4d1j:B, 4d1j:C, 4d1j:E, 4d1j:F, 4d1j:G, 4d1j:H, 5jaw:A, 5jaw:D, 5jaw:B, 5jaw:C, 5jaw:E, 5jaw:F, 5jaw:G, 5jaw:H, 8pej:A, 8pej:B, 8pej:C, 8pej:D, 8pej:E, 8pej:F, 8pej:G, 8pej:H, 6tbf:A, 6tbf:B, 6tbf:C, 6tbf:D, 6tbf:E, 6tbf:F, 6tbf:G, 6tbf:H, 6tbg:A, 6tbg:B, 6tbg:C, 6tbg:D, 6tbg:E, 6tbg:F, 6tbg:G, 6tbg:H, 6tbh:A, 6tbh:C, 6tbh:B, 6tbh:D, 6tbh:E, 6tbh:G, 6tbh:F, 6tbh:H, 6tbi:A, 6tbi:B, 6tbi:C, 6tbi:D, 6tbi:E, 6tbi:F, 6tbi:G, 6tbi:H, 6tbj:A, 6tbj:B, 6tbj:C, 6tbj:D, 6tbj:E, 6tbj:F, 6tbj:G, 6tbj:H, 6tbk:A, 6tbk:B, 6tbk:C, 6tbk:D, 6tbk:E, 6tbk:F, 6tbk:G, 6tbk:H |
9 | 8wp1:A | 304 | 67 | 0.0680 | 0.0691 | 0.3134 | 6.6 | 8jpn:R |
10 | 5wid:A | 144 | 54 | 0.0485 | 0.1042 | 0.2778 | 7.7 | 5wid:B, 5wid:C |
11 | 5xyf:A | 192 | 18 | 0.0227 | 0.0365 | 0.3889 | 7.9 | |
12 | 3din:A | 816 | 45 | 0.0356 | 0.0135 | 0.2444 | 8.6 | 3din:B, 3jux:A, 4ys0:A |