BioLiP

>protein
QAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELSVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDH
HIVALYQNALDHLQESR

The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1r23:A	104	96	0.9691	0.9038	0.9792	7.41e-63	1r22:A, 1r22:B, 1r23:B
2	6cdb:A	97	90	0.3505	0.3505	0.3778	6.97e-18	6cda:A, 6cdb:B, 4ggg:A, 4ggg:B, 2m30:A, 2m30:B, 1r1v:A
3	4omy:A	97	78	0.3196	0.3196	0.3974	1.65e-12	4omy:B, 4omy:C, 4omy:D, 4on0:A, 4on0:B, 4on0:C, 4on0:D
4	1u2w:B	107	87	0.3093	0.2804	0.3448	2.01e-11	1u2w:A, 1u2w:C
5	2jsc:B	97	73	0.2990	0.2990	0.3973	6.67e-09	2jsc:A
6	6o8m:A	95	86	0.2784	0.2842	0.3140	1.79e-07
7	1u2w:D	94	87	0.2680	0.2766	0.2989	2.16e-04
8	4kdp:A	151	72	0.1959	0.1258	0.2639	0.049	4ejv:A, 4ejv:B, 4ejw:A, 4ejw:B, 4kdp:B, 4kdp:C, 4kdp:D, 3kp2:A, 3kp2:B, 3kp3:B, 3kp4:A, 3kp4:B, 3kp5:A, 3kp5:B
9	8y6u:H	92	53	0.2062	0.2174	0.3774	0.34	8y6u:J
10	2pij:A	59	32	0.1340	0.2203	0.4062	1.1
11	9bh5:AK	93	41	0.1649	0.1720	0.3902	2.2	9cai:AK
12	5b6a:A	288	43	0.1753	0.0590	0.3953	3.3
13	5wci:A	284	39	0.1340	0.0458	0.3333	4.7	6ba2:A, 6ba4:A, 7cmr:A, 6ct2:A, 4dnc:A, 4dnc:B, 2giv:A, 5j8c:A, 5j8f:A, 6oin:A, 6oio:A, 6oip:A, 6oiq:A, 6oir:A, 6owh:A, 6owi:A, 6pd8:A, 6pd9:A, 6pda:A, 6pdb:A, 6pdc:A, 6pdd:A, 6pde:A, 6pdf:A, 6pdg:A, 2pq8:A, 3qah:A, 3toa:A, 3tob:A, 8w13:A, 2y0m:A
14	8c3a:w	199	47	0.1546	0.0754	0.3191	7.3	8c3a:BJ, 8cq7:w, 8cq7:BJ, 8cqw:w, 8cqw:BJ, 8cre:w, 8cre:BJ, 8oeq:w, 8oeq:BJ, 7pzy:w, 7q08:w, 7q0f:w, 7q0p:w, 7q0r:w, 8q5i:w

[Back]