QAALRNQQAMAANLQARQIVLQQSYPVIQQVETQTFDPANRSVFDVTPANVGIVKGFLVKVTAAITNNHATEAVALTDFG
PANLVQRVIYYDPDNQRHTETSGWHLHFVNTAKQGAPFLSSMVTDSPIKYGDVMNVIDAPATIAAGATGELTMYYWVPLA
YSETDLTGAVLANVPQSKQRLKLEFANNNTAFAAVGANPLEAIYQGAGAADCEFEEISYTVYQSYLDQLPVGQNGYILPL
IDLSTLYNLENSAQAGLTPNVDFVVQYANLYRYLSTIAVFDNGGSFNAGTDINYLSQRTANFSDTRKLDPKTWAAQTRRR
IATDFPKGVYYCDNRDKPIYTLQYGNVGFVVNPKTVNQNARLLMGYEYFTSRT
The query sequence (length=373) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ook:C | 373 | 373 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7ook:B, 7ook:A |
2 | 6jig:A | 480 | 56 | 0.0483 | 0.0375 | 0.3214 | 0.33 | 6lk4:A |
3 | 1x4i:A | 70 | 23 | 0.0322 | 0.1714 | 0.5217 | 0.77 | 7zmx:A, 7zmx:B |
4 | 2zni:A | 279 | 77 | 0.0536 | 0.0717 | 0.2597 | 0.90 | 2zni:B |
5 | 3i58:A | 328 | 51 | 0.0456 | 0.0518 | 0.3333 | 1.0 | 3i53:A, 3i53:B, 3i58:B, 3i5u:A, 3i5u:B, 3i64:A, 3i64:B |
6 | 6jq9:B | 483 | 110 | 0.0751 | 0.0580 | 0.2545 | 2.5 | 6byp:A, 6byp:B, 6byt:A, 6byt:B, 6byx:A, 6byx:B, 6jq9:A |
7 | 5mtw:C | 138 | 95 | 0.0670 | 0.1812 | 0.2632 | 7.5 | 5mtw:A, 5mtw:D, 5mtw:B |
8 | 5msd:A | 636 | 61 | 0.0483 | 0.0283 | 0.2951 | 8.7 | 5msc:A, 5msq:A |