BioLiP

>protein
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6fgp:B	68	67	0.9701	0.9559	0.9701	7.18e-45	1b3a:B, 1b3a:A, 5coy:A, 5dnf:C, 5dnf:D, 5dnf:I, 5dnf:A, 5dnf:F, 5dnf:G, 5dnf:H, 1u4l:A, 1u4m:A
2	7f1t:A	423	66	0.4776	0.0757	0.4848	1.99e-19	6akx:A, 6akx:B, 6aky:A, 5d65:B, 5d65:A, 5d65:D, 4mbs:A, 4mbs:B, 5uiw:A
3	2ra4:B	65	58	0.2836	0.2923	0.3276	1.11e-11
4	2mpm:A	74	61	0.3582	0.3243	0.3934	5.87e-11
5	4r8i:A	68	58	0.2836	0.2794	0.3276	1.05e-07
6	2hci:A	68	58	0.2836	0.2794	0.3276	1.05e-04
7	2nwg:A	68	45	0.2239	0.2206	0.3333	6.80e-04	2nwg:B, 4uai:A
8	6gwi:B	450	41	0.2090	0.0311	0.3415	0.14	6gwi:A
9	1ilp:A	71	57	0.2090	0.1972	0.2456	0.19	1ilq:A, 6xmn:A
10	4v6w:Ac	62	44	0.1791	0.1935	0.2727	0.70	6xu6:Ac, 6xu7:Ac, 6xu8:Ac
11	6edk:A	193	18	0.1045	0.0363	0.3889	2.4	6ci4:A, 6ci5:A
12	6q2m:A	544	22	0.1642	0.0202	0.5000	4.3	1ba3:A, 5dwv:A, 4e5d:A, 4g36:A, 4g36:B, 4g37:A, 4g37:B, 5gyz:A, 5gz2:A, 6hps:A, 6hps:B, 3ies:A, 5kyt:A, 5kyt:B, 5kyv:A, 5kyv:B, 6q2m:B, 6q2m:C, 3rix:A, 5wys:A
13	3e78:A	365	36	0.1642	0.0301	0.3056	7.3	3e79:A, 3eki:A
14	7t80:A	216	32	0.1791	0.0556	0.3750	9.0	7t80:B
15	5mr0:D	290	32	0.1642	0.0379	0.3438	9.3	5mr0:A, 5mr0:B, 5mr0:C, 5mr0:E, 5mr0:F
16	2d74:B	137	57	0.2537	0.1241	0.2982	9.8	2dcu:B

[Back]