BioLiP

>protein
PTRTLVMTSMPSEKQNVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELGHWISE
EPFELSHHFPAAPLCRSECHLSAGPYRGTLFADQPVMFVSPASSPPVAKLCELVHLCGGRVSQVPRQASIVIGPYSGKKK
ATVKYLSEKWVLDSITQHKVCAPENYLLS

The query sequence (length=189) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3szm:C	191	189	1.0000	0.9895	1.0000	1.88e-140	3shv:A, 3shv:B, 3szm:A, 3szm:B, 3szm:D, 3szm:E, 3szm:F, 3szm:G, 3szm:H, 3t1n:A, 3t1n:B, 3u3z:A
2	4u4a:A	214	185	0.2434	0.2150	0.2486	5.06e-07	3coj:X, 3coj:A, 3coj:F, 3coj:B, 3coj:C, 3coj:D, 3coj:E, 3coj:G, 4ifi:A, 4igk:A, 4igk:B, 4jlu:A, 3k0h:A, 3k0k:A, 3k15:A, 3k16:A, 4ofb:A, 3pxe:A, 3pxe:B, 3pxe:C, 3pxe:D, 1t15:A, 1t29:A, 1t2v:A, 1t2v:E, 1t2v:B, 1t2v:C, 1t2v:D, 4u4a:B, 4u4a:C, 4y18:A, 4y18:B, 4y18:C, 4y18:D, 4y18:E, 4y18:F, 4y18:G, 4y18:H, 4y2g:A, 1y98:A
3	8ir2:B	198	84	0.1058	0.1010	0.2381	1.03e-05	8ir2:A, 8ir4:A, 8ir4:B
4	3al3:A	218	79	0.1217	0.1055	0.2911	2.04e-05	7cmz:A
5	3k05:B	200	174	0.2222	0.2100	0.2414	5.59e-05	2azm:A, 2azm:B, 3k05:A
6	3l41:A	214	184	0.2275	0.2009	0.2337	0.001
7	8tlq:B	248	81	0.1111	0.0847	0.2593	1.5
8	6jci:A	704	23	0.0688	0.0185	0.5652	3.8
9	6ubb:C	249	42	0.0582	0.0442	0.2619	4.3	6uba:A, 6uba:B, 6uba:C, 6uba:D, 6uba:E, 6uba:F, 6uba:G, 6uba:H, 6uba:I, 6uba:J, 6ubb:A, 6ubb:B, 6ubb:D, 6ubb:E, 6ubb:F, 6ubb:G, 6ubb:H, 6ubb:I, 6ubb:J
10	7wjl:A	453	66	0.0899	0.0375	0.2576	4.5
11	7tz4:A	530	63	0.1058	0.0377	0.3175	5.5	7tyb:A
12	2ocx:A	292	39	0.0635	0.0411	0.3077	5.7	2hhc:A, 2hlh:A, 3siw:A, 3six:A
13	8r8r:A	1188	83	0.1005	0.0160	0.2289	6.4

[Back]