Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PTHRHIRGEACPLPHRLNSLGGCRCGKYPNLKKPTVWRRGH

The query sequence (length=41) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 2l0z:A 41 41 1.0000 1.0000 1.0000 3.89e-25
2 8k5o:w 63 30 0.2439 0.1587 0.3333 1.0 8k5o:Y, 8k5o:b, 8k5o:k, 8k5o:n, 8k5o:t, 8k5o:z, 8k5o:6, 8k5o:F, 8k5o:K, 8k5o:P, 8k5o:S, 8k5o:V, 8k5o:e, 8k5o:h, 8k5o:q
3 5c4i:E 312 12 0.2195 0.0288 0.7500 1.5 5c4i:B, 5exd:E, 5exe:B
4 5exd:H 291 12 0.2195 0.0309 0.7500 1.8 5exd:B, 5exd:K, 5exe:E
5 7ela:A 1402 21 0.2439 0.0071 0.4762 1.9
6 7ckl:A 1415 21 0.2439 0.0071 0.4762 1.9
7 6klc:A 1436 21 0.2439 0.0070 0.4762 1.9
8 5vkw:B 469 23 0.2195 0.0192 0.3913 4.2
9 6fd2:A 454 17 0.1707 0.0154 0.4118 7.8 6fd2:B
10 4zm4:D 387 18 0.2195 0.0233 0.5000 8.5
11 4zm4:B 425 18 0.2195 0.0212 0.5000 8.6 4zm3:A, 4zm3:B, 4zm3:C, 4zm3:D, 4zm4:A, 4zm4:C, 4zm4:E, 4zm4:F

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218