BioLiP

>protein
PSPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHAT
LNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFG

The query sequence (length=134) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5fw5:A	139	133	0.9925	0.9568	1.0000	4.62e-99	4fcm:A, 4fcm:B, 7suo:A, 7suo:B, 6ta7:D, 6ta7:E, 6ta7:F, 8th1:A, 8th1:B, 8th1:C, 8th1:D, 8th5:A, 8th5:C, 8th5:F, 8th5:B, 8th5:E, 8th5:D, 8th6:D, 8th6:C, 8th6:B, 8th6:A, 8th7:A, 8th7:B, 8v1l:A, 8v1l:B, 8v1l:C, 8v1l:D, 8v1l:E, 8v1l:F, 7xhf:A, 7xhf:B, 7xhg:B, 7xhg:C, 7xhg:D
2	5drv:A	131	134	0.7761	0.7939	0.7761	7.62e-74
3	8th5:I	119	133	0.8507	0.9580	0.8571	2.98e-73
4	3ujm:A	117	126	0.5672	0.6496	0.6032	3.54e-48	3ujm:B
5	1gyb:B	122	78	0.2313	0.2541	0.3974	4.55e-07	1gyb:D, 1gyb:C
6	2qiy:A	134	127	0.2388	0.2388	0.2520	5.21e-05	2qiy:B
7	3u43:B	132	80	0.1493	0.1515	0.2500	0.046
8	8ro2:L2	369	53	0.1194	0.0434	0.3019	1.6	6id0:U, 6id1:U
9	6uel:A	1333	55	0.1567	0.0158	0.3818	2.4	6uel:B
10	5ihx:A	360	50	0.0896	0.0333	0.2400	2.6
11	7u1b:A	403	112	0.1866	0.0620	0.2232	5.4
12	8hra:C	852	47	0.1269	0.0200	0.3617	6.1	8hr8:A, 8hr8:C, 8hr8:F, 8hr8:H, 8hr9:A, 8hr9:C, 8hr9:F, 8hr9:H, 8hr9:I, 8hr9:J, 8hr9:M, 8hr9:O, 8hra:D, 8hra:E, 8hra:H, 8hra:A, 8hra:B, 8hra:G, 8hrb:D, 8hrb:E, 8hrb:C, 8hrb:H, 8hrb:A, 8hrb:B, 8hrb:M, 8hrb:P, 8hrb:L, 8hrb:R, 8hrb:F, 8hrb:K, 8hrb:Q, 8hrb:G
13	8hr8:G	830	47	0.1269	0.0205	0.3617	6.3	8hr9:G, 8hr9:N
14	7w6d:A	104	27	0.0672	0.0865	0.3333	8.6	5b09:A, 7w6d:B, 7w6e:A, 7w6e:B, 7w6f:A, 7w6f:B
15	8e7f:A	614	34	0.0970	0.0212	0.3824	9.7

[Back]