PRVLAERGEGHRFVELALRGGPGWCDLCGREVLRQALRCANCKFTCHSECRSLIQLDCR
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2fnf:X | 59 | 59 | 1.0000 | 1.0000 | 1.0000 | 4.83e-38 | 1rfh:A |
2 | 3cxl:A | 402 | 60 | 0.3220 | 0.0473 | 0.3167 | 1.11e-06 | |
3 | 4l9m:A | 522 | 41 | 0.2373 | 0.0268 | 0.3415 | 6.76e-06 | |
4 | 2db6:A | 74 | 59 | 0.2881 | 0.2297 | 0.2881 | 3.27e-05 | |
5 | 1xa6:A | 399 | 52 | 0.2712 | 0.0401 | 0.3077 | 5.03e-05 | |
6 | 5ue8:A | 847 | 27 | 0.1864 | 0.0130 | 0.4074 | 1.35e-04 | 5ue8:B, 1y8f:A |
7 | 6uwa:A | 187 | 43 | 0.2203 | 0.0695 | 0.3023 | 0.005 | 1dsy:A, 3gpe:A, 2nce:A, 3twy:A, 5w4s:A |
8 | 7z6e:C | 534 | 52 | 0.2542 | 0.0281 | 0.2885 | 0.007 | 7z6e:A, 7z6e:B, 7z6e:D, 7z6e:E |
9 | 2eli:A | 85 | 43 | 0.2203 | 0.1529 | 0.3023 | 0.015 | |
10 | 6ra0:A | 138 | 40 | 0.2203 | 0.0942 | 0.3250 | 0.018 | |
11 | 8adl:C | 782 | 26 | 0.1695 | 0.0128 | 0.3846 | 0.034 | 8adl:Q |
12 | 3uej:A | 65 | 47 | 0.2542 | 0.2308 | 0.3191 | 0.042 | 7knd:A, 7knj:A, 7ko6:A, 7l92:A, 7l92:D, 7l92:G, 7l92:J, 7l92:M, 7l92:V, 7l92:P, 7l92:S, 7lcb:A, 7leo:A, 7leo:D, 7lf3:A, 1ptq:A, 1ptr:A, 3uej:B, 3uey:A, 3uey:B, 3uff:A, 3uff:B, 3ugd:A, 3ugd:B, 3ugi:A, 3ugi:B, 3ugl:A, 3ugl:B |
13 | 2e73:A | 77 | 53 | 0.2373 | 0.1818 | 0.2642 | 0.082 | |
14 | 4b6d:A | 60 | 50 | 0.2712 | 0.2667 | 0.3200 | 0.31 | 4b6d:B, 4b6d:C, 4b6d:D, 4b6d:E, 4b6d:F |
15 | 2enz:A | 65 | 47 | 0.2373 | 0.2154 | 0.2979 | 1.2 | |
16 | 4fkd:A | 65 | 47 | 0.2373 | 0.2154 | 0.2979 | 1.6 | |
17 | 1txo:B | 236 | 12 | 0.1525 | 0.0381 | 0.7500 | 2.4 | 2cm1:A, 1txo:A |
18 | 7ypn:D | 455 | 26 | 0.1695 | 0.0220 | 0.3846 | 3.1 | 7ypm:A, 7ypm:B, 7ypm:D, 7ypm:C, 7ypn:B |
19 | 6zq4:F | 512 | 23 | 0.1695 | 0.0195 | 0.4348 | 3.4 | 6zq4:A, 6zq4:B, 6zq4:C, 6zq4:D, 6zq4:E, 6zq4:G, 6zq4:H, 6zq6:A, 6zq6:B, 6zq6:C, 6zq6:D, 6zq7:A |
20 | 2a7j:A | 240 | 40 | 0.2034 | 0.0500 | 0.3000 | 3.6 | 1b0e:A, 8b04:A, 8b1y:A, 8b49:A, 8b53:A, 2bb4:A, 2bd2:A, 2bd3:A, 2bd4:A, 2bd5:A, 2bd7:A, 2bd8:A, 2bd9:A, 2bda:A, 2bdb:A, 2bdc:A, 2blo:A, 2blq:A, 1bma:A, 1btu:A, 1c1m:A, 2cv3:A, 2de9:A, 1e34:B, 1e35:B, 1e36:B, 1e37:B, 1e38:B, 3e3t:A, 1eas:A, 1eat:A, 1eau:A, 1ela:A, 1elb:A, 1elc:A, 1eld:E, 1ele:E, 1elf:A, 1elg:A, 1esa:A, 1esb:A, 1est:A, 2est:E, 3est:A, 4est:E, 5est:E, 6est:A, 7est:E, 8est:E, 9est:A, 7fag:A, 2fo9:A, 2foa:A, 2fob:A, 2foc:A, 2fod:A, 2foe:A, 2fof:A, 2fog:A, 2foh:A, 1fzz:A, 2g4t:A, 2g4u:A, 1gvk:B, 4gvu:A, 1gwa:A, 2h1u:A, 1h9l:B, 1hax:B, 1hay:B, 1haz:B, 1hb0:B, 3hgn:A, 3hgp:A, 1hv7:A, 1inc:A, 2iot:A, 1jim:A, 1l0z:A, 1l1g:A, 1lka:A, 1lkb:A, 1lvy:A, 1mcv:A, 1mmj:N, 1nes:E, 1okx:A, 1okx:B, 2oqu:A, 6qbu:A, 6qen:A, 6qeo:A, 1qgf:A, 1qix:B, 1qr3:E, 6th7:A, 6th7:B, 1uo6:A, 1uvo:A, 1uvp:A, 2v0b:A, 2v35:A, 4ym9:A |
21 | 6jkh:A | 212 | 23 | 0.1864 | 0.0519 | 0.4783 | 3.7 | 6jkh:B |
22 | 6p07:B | 303 | 42 | 0.2373 | 0.0462 | 0.3333 | 4.4 | 6nyv:B, 6nyw:B, 6p07:C, 6p07:D, 6p07:E, 6p07:F, 6p10:B, 6p11:B, 6p12:B, 6p13:B |
23 | 6v35:H | 198 | 17 | 0.1356 | 0.0404 | 0.4706 | 7.3 | 6v35:E, 6v35:F, 6v35:G |
24 | 1v7v:A | 779 | 16 | 0.1356 | 0.0103 | 0.5000 | 9.4 | 1v7w:A, 1v7x:A |