BioLiP

>protein
PQNMAFRAKATRTARRESQETFWSRFGISQSCGSRFENGENLPFPIYLLLHFYIEGQITDRQLADLRG

The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5j2y:A	70	68	1.0000	0.9714	1.0000	3.52e-47	5j2y:B
2	3pa1:A	315	42	0.1912	0.0413	0.3095	0.33	5bsx:A, 5bsy:A, 6gw1:A, 6gw1:B, 6gw2:A, 6gw2:B, 6gy9:A, 6gy9:B, 5hza:A, 5hza:B, 5hzb:B, 5hzb:A, 3ony:A, 3ony:B, 3ony:C, 3pa1:B, 3pa2:A, 3pa2:B, 3q38:A, 3q39:A, 3q39:B, 3q3a:B, 3q3a:A, 3ry8:A, 8y6c:B, 8y6c:A, 8y6d:B, 8y6d:A, 4z4r:A, 4z4r:B, 4z4s:A, 4z4s:B, 4z4t:A, 4z4t:B, 4z4u:A, 4z4u:B, 4z4v:A, 4z4v:B, 4z4w:A, 4z4w:B, 4z4y:A, 4z4z:A, 4z4z:B
3	8tac:B	66	39	0.1912	0.1970	0.3333	1.1
4	8ch6:V	285	46	0.2206	0.0526	0.3261	1.2	7qtt:V
5	8i0s:Y	320	46	0.2206	0.0469	0.3261	1.2	8i0t:Y, 8i0u:Y, 8i0v:Y
6	1pp9:O	424	19	0.1471	0.0236	0.5263	6.5	2a06:B, 4d6t:B, 4d6t:O, 4d6u:B, 4d6u:O, 7dgq:l, 7dgq:x, 7dgr:l, 7dgr:x, 7dgs:l, 7dgs:x, 6fo0:O, 6fo0:B, 6fo2:O, 6fo2:B, 1pp9:B, 1ppj:O, 1ppj:B, 6qbx:a2, 6qbx:a4, 6qc3:a2, 6qc3:a4, 7tz6:B, 7tz6:O
7	4krg:A	466	23	0.1176	0.0172	0.3478	7.9	4krg:B
8	5myo:B	221	15	0.1176	0.0362	0.5333	9.5	4i9w:G, 7lj4:G, 7lj5:G, 7lja:G, 7ljb:G, 4wfe:G, 4wff:G, 4wfg:G, 4wfh:G

[Back]