BioLiP

>protein
PQFEKIEGRMIRILYLLVKPESMSHEQFRKECVVHFQMSAGMPGLHKYEVRLVAGNPTDTHVPYLDVGRIDAIGECWFAS
EEQYQVYMESDIRKAWFEHGKYFIGQLKPFVTEELV

The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3hds:A	116	116	1.0000	1.0000	1.0000	2.86e-85	3hds:D, 3hds:B, 3hds:C, 3hf5:A, 3hf5:B, 3hf5:C, 3hf5:D, 3hfk:A, 3hfk:B, 3hfk:C, 3hfk:D
2	8q9x:A	471	48	0.1293	0.0318	0.3125	1.6	8q9x:B, 8q9y:A, 8q9y:B, 8you:A, 8you:B, 8yu5:A, 8yu5:B, 8yu6:A, 8yu6:B, 8z75:A, 8z75:B, 8z75:C, 8z76:A, 8z76:B, 8z76:C, 8z77:A, 8z77:B, 8z77:C
3	7aor:ar	255	35	0.0862	0.0392	0.2857	2.3
4	5gl5:A	431	29	0.0948	0.0255	0.3793	3.2	5gl5:B
5	6hiv:DQ	256	59	0.1466	0.0664	0.2881	3.5	6hiw:DQ, 6hiy:DQ, 7pub:DQ
6	3ma0:A	313	63	0.1379	0.0511	0.2540	3.6	3m9x:A, 3ma0:B, 3ma0:C
7	2v25:A	231	39	0.1121	0.0563	0.3333	4.2	2v25:B
8	1ycd:B	238	20	0.0603	0.0294	0.3500	4.7	1ycd:A
9	4f10:A	353	36	0.1034	0.0340	0.3333	7.5	4f10:B, 4f13:A, 4f13:B, 1hv6:A, 1qaz:A
10	9emu:C	227	10	0.0862	0.0441	1.0000	7.7	9emu:A, 9emu:B, 9emu:D
11	9c8v:B	434	40	0.0948	0.0253	0.2750	9.2	8d0k:E, 8d96:B, 8d9d:B, 5exr:B, 5exr:F, 5f0q:A, 5f0q:B, 5f0s:A, 5f0s:B, 3l9q:A, 7opl:D, 3q36:A, 3q36:B, 8qj7:D, 4rr2:D, 7u5c:B, 8vy3:B

[Back]