PPQYMIDLYNRYTTDKSSTPASNIVRSFSVEDAISTAATEDFPFQKHILIFNISIPRHEQITRAELRLYVSCQNDVDSTH
GLEGSMVVYDVLEDSETWDQATGTKTFLVSQDIRDEGWETLEVSSAVKRWVRADSTTNKNKLEVTVQSHRESCDTLDISV
PPGSKNLPFFVVFSNDRSNGTKETRLELKEMIGHEQ
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4ycg:B | 198 | 196 | 1.0000 | 0.9899 | 1.0000 | 6.13e-148 | 4ycg:A, 4yci:A, 4yci:B |
2 | 8d0k:D | 419 | 49 | 0.0816 | 0.0382 | 0.3265 | 1.8 | 4bpu:A, 4bpu:C, 4bpw:A, 4bpw:C, 4bpx:A, 4bpx:C, 9c8v:A, 8d9d:A, 5exr:A, 5exr:E, 4lik:A, 4lil:A, 4mhq:A, 7opl:C, 8qj7:C, 6r4s:A, 6r4s:E, 6r4t:A, 6r4t:D, 6r4u:A, 6r4u:E, 6r5d:A, 6r5d:E, 6r5e:A, 6r5e:E, 6rb4:A, 4rr2:A, 4rr2:C, 7u5c:A |
3 | 7pua:IA | 704 | 85 | 0.1071 | 0.0298 | 0.2471 | 2.8 | 7pub:IA |
4 | 7ycx:K | 590 | 89 | 0.1429 | 0.0475 | 0.3146 | 6.4 | 7cun:K, 8r22:C, 8r23:C, 8r2d:C, 8rc4:k, 8uib:K |
5 | 3jd5:k | 275 | 52 | 0.0765 | 0.0545 | 0.2885 | 9.4 | 8oin:AB, 8oip:AB, 6ydw:Ak |