PPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVH
WQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1bmo:A | 233 | 151 | 1.0000 | 0.6481 | 1.0000 | 5.75e-111 | 1bmo:B, 1nub:A, 1nub:B, 1sra:A, 2v53:A |
2 | 7kbu:A | 221 | 150 | 0.6026 | 0.4118 | 0.6067 | 6.70e-65 | 7kbu:B |
3 | 5joj:A | 97 | 72 | 0.1589 | 0.2474 | 0.3333 | 0.013 | |
4 | 7xzi:D | 101 | 42 | 0.0993 | 0.1485 | 0.3571 | 0.31 | |
5 | 1k26:A | 150 | 39 | 0.0596 | 0.0600 | 0.2308 | 0.50 | |
6 | 8bav:C | 264 | 77 | 0.1391 | 0.0795 | 0.2727 | 0.63 | 8bav:D |
7 | 8ban:C | 251 | 77 | 0.1391 | 0.0837 | 0.2727 | 0.75 | 8ban:D, 8bbj:C, 8bbj:D |
8 | 6hiv:Cv | 1059 | 70 | 0.1457 | 0.0208 | 0.3143 | 1.2 | 6hiw:Cv, 6hiy:Cv, 7pub:Cv |
9 | 4v12:A | 337 | 69 | 0.1325 | 0.0593 | 0.2899 | 1.2 | |
10 | 7l08:q | 168 | 54 | 0.1192 | 0.1071 | 0.3333 | 3.7 | 7a5f:q3, 7a5g:q3, 7a5i:q3, 7a5j:q, 7a5k:q3, 8any:q, 6i9r:q, 8k2a:L8, 8k2b:L8, 7l20:q, 6nu2:q, 6nu3:q, 7o9k:q, 7o9m:q, 7odr:q, 7ods:q, 7odt:q, 7of0:q, 7of2:q, 7of3:q, 7of4:q, 7of5:q, 7of6:q, 7of7:q, 7og4:q, 7oi8:q, 7oia:q, 7oic:q, 7oid:q, 8oir:Bg, 8oit:Bg, 8pk0:q, 7po4:q, 7qh6:q, 7qh7:q, 7qi4:q, 7qi5:q, 7qi6:q, 8qsj:q, 6vlz:q, 6vmi:q, 8xt0:L8, 8xt1:L8, 8xt2:L8, 8xt3:L8, 6zm5:q, 6zm6:q, 6zs9:q, 6zsa:q, 6zsb:q, 6zsc:q, 6zsd:q, 6zse:q, 6zsg:q |
11 | 1mc3:A | 291 | 32 | 0.0927 | 0.0481 | 0.4375 | 5.3 | 1mc3:B |
12 | 6b03:A | 896 | 22 | 0.0596 | 0.0100 | 0.4091 | 6.0 | 6b05:A, 6brs:A |
13 | 1w6j:A | 727 | 44 | 0.1192 | 0.0248 | 0.4091 | 6.6 | 1w6k:A |