PNSGTLALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQITMEK
TPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNGLIDTSWSAIQIGIYAKHLEHW
LRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFPCLKKAEGSSRPHCLGKTKGRTHPEIDRE
VVRRLREFYRPFNLKFYQMTGHDFGWDG
The query sequence (length=268) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1t8t:B | 271 | 271 | 1.0000 | 0.9889 | 0.9889 | 0.0 | 1t8t:A, 1t8u:B, 1t8u:A, 6xkg:A, 6xkg:B, 6xl8:A, 6xl8:B |
2 | 7scd:A | 371 | 260 | 0.4739 | 0.3423 | 0.4885 | 8.32e-83 | 3bd9:A, 7sce:A |
3 | 1zrh:A | 263 | 260 | 0.4179 | 0.4259 | 0.4308 | 1.54e-76 | 3uan:A, 3uan:B, 1vkj:A, 1vkj:B, 1vkj:C |
4 | 8ccy:A | 754 | 269 | 0.3060 | 0.1088 | 0.3048 | 1.07e-31 | 1nst:A |
5 | 8chs:A | 718 | 269 | 0.3022 | 0.1128 | 0.3011 | 1.43e-30 | 8cd0:A |
6 | 3rnl:A | 247 | 200 | 0.1940 | 0.2105 | 0.2600 | 1.10e-08 | |
7 | 5x2b:L | 283 | 107 | 0.0970 | 0.0919 | 0.2430 | 0.008 | 5x2b:C, 5x2b:A, 5x2b:B, 5x2b:D, 5x2b:E, 5x2b:F, 5x2b:G, 5x2b:H, 5x2b:I, 5x2b:J, 5x2b:K |
8 | 1x8k:A | 344 | 106 | 0.1194 | 0.0930 | 0.3019 | 0.027 | 1fmj:A, 1fmj:B, 1fml:A, 1fml:B, 1x8j:A, 1x8j:B, 1x8k:B, 1x8l:A, 1x8l:B |
9 | 3ap2:A | 300 | 206 | 0.1716 | 0.1533 | 0.2233 | 0.041 | 3ap1:A, 3ap1:B, 3ap2:B, 3ap3:A, 3ap3:B, 3ap3:C, 3ap3:D |
10 | 2gwh:B | 288 | 105 | 0.1045 | 0.0972 | 0.2667 | 0.064 | 2gwh:A |
11 | 1q20:A | 294 | 137 | 0.1231 | 0.1122 | 0.2409 | 0.071 | 1q1q:A, 1q1z:A, 1q22:A |
12 | 5ylz:I | 517 | 146 | 0.1269 | 0.0658 | 0.2329 | 0.13 | |
13 | 5wnb:H | 226 | 48 | 0.0597 | 0.0708 | 0.3333 | 0.25 | 5wnb:I |
14 | 4eec:A | 253 | 102 | 0.0970 | 0.1028 | 0.2549 | 0.26 | 2ovb:A, 2ovf:A |
15 | 3bfx:A | 253 | 105 | 0.1082 | 0.1146 | 0.2762 | 0.28 | 3bfx:B |
16 | 1eyy:A | 504 | 33 | 0.0597 | 0.0317 | 0.4848 | 0.45 | 1eyy:B, 1eyy:C, 1eyy:D, 1ez0:A, 1ez0:B, 1ez0:C, 1ez0:D |
17 | 2buj:A | 291 | 64 | 0.0746 | 0.0687 | 0.3125 | 0.84 | 2buj:B |
18 | 8w5z:A | 333 | 68 | 0.0821 | 0.0661 | 0.3235 | 1.2 | 8w5z:C |
19 | 5wrj:A | 275 | 205 | 0.1493 | 0.1455 | 0.1951 | 2.0 | 5wri:A, 5wri:B, 5wrj:B, 5wrj:C, 5wrj:D |
20 | 8t4j:A | 552 | 59 | 0.0709 | 0.0344 | 0.3220 | 2.4 | 1jj7:A, 8t4e:A, 8t4f:A, 8t4g:A, 8t4h:A, 8t4i:A |
21 | 5fal:A | 435 | 65 | 0.0746 | 0.0460 | 0.3077 | 4.0 | 5fan:A, 4kec:A |
22 | 2ixf:A | 255 | 25 | 0.0410 | 0.0431 | 0.4400 | 5.4 | 2ixe:A, 2ixe:D, 2ixf:B, 2ixf:C, 2ixf:D, 2ixg:A, 4k8o:A |
23 | 3u3k:A | 289 | 101 | 0.0746 | 0.0692 | 0.1980 | 7.8 | 2a3r:A, 2a3r:B, 2d06:A, 2d06:B, 4gra:A, 4gra:B, 1ls6:A, 3qvu:A, 3qvu:B, 3qvv:A, 3qvv:B, 3u3j:A, 3u3j:B, 3u3k:B, 3u3m:A, 3u3o:A, 3u3r:A, 1z28:A, 1z29:A |
24 | 8dgc:A | 2028 | 87 | 0.0784 | 0.0104 | 0.2414 | 8.3 | 8dgc:B, 8dgc:C, 8dgc:D |