PMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMR
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7zi4:R | 101 | 72 | 1.0000 | 0.7129 | 1.0000 | 1.82e-47 | 6hts:R |
2 | 1x4s:A | 59 | 23 | 0.1528 | 0.1864 | 0.4783 | 1.8 | |
3 | 9cer:P | 609 | 23 | 0.1667 | 0.0197 | 0.5217 | 2.3 | 9ces:P, 9cet:P |
4 | 2yqp:A | 60 | 43 | 0.2083 | 0.2500 | 0.3488 | 2.3 | |
5 | 8rw1:k | 470 | 28 | 0.1389 | 0.0213 | 0.3571 | 4.7 | 6fyx:k, 6gsm:k, 6gsn:k, 6qg0:M, 6qg0:N, 6qg1:M, 6qg1:N, 6qg2:M, 6qg3:M, 6qg5:M, 6qg6:M, 6qg6:N, 8s8d:k, 8s8e:k, 8s8g:k, 8s8h:k, 8s8i:k, 8s8j:k |
6 | 3gd9:A | 362 | 44 | 0.2222 | 0.0442 | 0.3636 | 9.9 |