PLRLLSSVHYLTGELPQLYDYPDDGTWLRANFISSLDGGATVTSGAMAGPGDRFVFNLLRELADVIVVGVGTVRVRMGVV
QRQHRQARGQSEVPQLAIVTRSGRLDRDMAVFTRTEMAPLVLTTTAVADDTRQRLAGLAEVIACSGDDPGTVDEAVLVSQ
LAARGLRRILTEGGPTLLGTFVERDVLDELCLTIAPYVVGGLARRIVTGPGQVLTRMRCAHVLTDDSGYLYTRYVKT
The query sequence (length=237) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6de5:A | 246 | 246 | 1.0000 | 0.9634 | 0.9634 | 1.28e-163 | 4xrb:A, 4xt4:A, 4xt5:A, 4xt6:A, 4xt7:A, 4xt8:A |
2 | 2o7p:A | 358 | 79 | 0.1181 | 0.0782 | 0.3544 | 6.80e-07 | 2o7p:B, 2obc:A |
3 | 6p8c:A | 216 | 190 | 0.2447 | 0.2685 | 0.3053 | 1.37e-06 | 6p8c:B |
4 | 5xv0:F | 239 | 149 | 0.1688 | 0.1674 | 0.2685 | 2.14e-06 | 5xux:A, 5xux:B, 5xux:C, 5xux:D, 5xux:E, 5xux:F, 5xv0:A, 5xv0:B, 5xv0:C, 5xv0:D, 5xv0:E, 5xv2:A |
5 | 8dqb:A | 370 | 62 | 0.0970 | 0.0622 | 0.3710 | 1.86e-05 | 8dq9:A, 8dq9:B, 8dqc:A, 8dqc:B |
6 | 2azn:A | 219 | 185 | 0.2025 | 0.2192 | 0.2595 | 3.22e-05 | 2azn:B, 2azn:C, 2azn:D, 2azn:E, 2azn:F |
7 | 4g3m:A | 361 | 190 | 0.2025 | 0.1330 | 0.2526 | 1.50e-04 | 2b3z:A, 2b3z:B, 2b3z:C, 2b3z:D, 2d5n:A, 2d5n:B, 2d5n:C, 2d5n:D, 3ex8:A, 3ex8:B, 3ex8:C, 3ex8:D, 4g3m:B, 4g3m:C, 4g3m:D |
8 | 1d1g:A | 164 | 46 | 0.0717 | 0.1037 | 0.3696 | 0.004 | 1d1g:B |
9 | 3zpc:A | 357 | 190 | 0.1983 | 0.1317 | 0.2474 | 0.029 | 3zpc:B, 3zpg:A |
10 | 3kgy:A | 218 | 83 | 0.0970 | 0.1055 | 0.2771 | 0.24 | 3kgy:B |
11 | 6uv8:A | 183 | 38 | 0.0591 | 0.0765 | 0.3684 | 2.8 | 6uvb:A |
12 | 6fah:E | 393 | 91 | 0.1181 | 0.0712 | 0.3077 | 3.8 | 6fah:A |
13 | 6l4c:C | 353 | 51 | 0.0675 | 0.0453 | 0.3137 | 5.1 | |
14 | 3f8p:D | 310 | 44 | 0.0675 | 0.0516 | 0.3636 | 5.6 | 3f8d:A, 3f8d:B, 3f8d:C, 3f8d:D, 3f8p:A, 3f8p:B, 3f8p:C, 3f8r:A, 3f8r:B, 3f8r:C, 3f8r:D |
15 | 6l4c:B | 373 | 51 | 0.0675 | 0.0429 | 0.3137 | 7.9 | 6l4c:A |
16 | 3eb0:A | 312 | 37 | 0.0633 | 0.0481 | 0.4054 | 10.0 | 3eb0:C |