BioLiP

>protein
PLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSV
LTQQALLQQHLNKIN

The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ecm:B	95	95	1.0000	1.0000	1.0000	1.03e-61	1ecm:A
2	2gtv:X	104	98	0.3263	0.2981	0.3163	3.99e-08
3	2ao2:A	165	58	0.2000	0.1152	0.3276	0.001	2ao2:B, 2ao2:C, 2fp2:B
4	5ckx:D	79	54	0.2211	0.2658	0.3889	0.011	5ckx:C, 2w1a:C, 2w1a:D
5	8pnj:A	390	80	0.2526	0.0615	0.3000	0.047
6	6al9:B	91	85	0.2632	0.2747	0.2941	0.090	6al9:A
7	5gmu:B	87	51	0.2000	0.2184	0.3725	0.11	5gmu:A
8	9c0i:A	425	77	0.2105	0.0471	0.2597	0.89	9c0j:A
9	5j6f:A	352	74	0.2316	0.0625	0.2973	1.1	5j6f:B
10	6ntw:A	505	64	0.2000	0.0376	0.2969	1.2
11	4lps:A	215	74	0.2211	0.0977	0.2838	1.6	4lps:B
12	8gix:E	991	55	0.1895	0.0182	0.3273	1.9
13	1l3l:B	233	27	0.1158	0.0472	0.4074	4.0	1h0m:A, 1h0m:B, 1h0m:C, 1h0m:D, 1l3l:D, 1l3l:A, 1l3l:C
14	5ne1:B	270	28	0.1579	0.0556	0.5357	5.3	5ne2:A, 5ne2:B, 5ne3:A, 5ne3:B, 6qw7:A, 6qw7:B
15	6ddg:Z	121	51	0.1895	0.1488	0.3529	8.3	7asm:L, 7aso:Q, 7asp:L, 6ddd:Z, 6fxc:AL, 6fxc:BL, 5hkv:K, 5hl7:K, 6hma:L, 5li0:Q, 5nd8:Q, 5nd9:Q, 5ngm:AL, 7nhl:Q, 7nhm:Q, 5nrg:K, 8p2f:Q, 8p2g:Q, 8p2h:Q, 7p48:L, 6s0x:L, 6s0z:L, 6s12:L, 6s13:L, 6sj6:Q, 5t7v:LQ, 5tcu:LQ, 7ttu:Z, 7ttw:Z, 4wce:K, 4wf9:K, 4wfa:K, 4wfb:K, 6wqn:Z, 6wqq:Z, 6wrs:Z, 6wru:Z, 8y36:L, 8y37:L, 8y38:L, 8y39:L, 6yef:Q

[Back]