PKRKKNPMQLRRKTYGLHFKERYLKLEEWYFCPLCAEPKKQGEWCRREDCRQIKP
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:T | 55 | 55 | 1.0000 | 1.0000 | 1.0000 | 2.02e-35 | 7am2:T, 7ane:T, 7aoi:A5, 6hiv:A5, 6hix:A5, 6yxx:A5, 6yxy:A5 |
2 | 7l5a:A | 477 | 24 | 0.1818 | 0.0210 | 0.4167 | 3.0 | |
3 | 6pl0:B | 608 | 24 | 0.1818 | 0.0164 | 0.4167 | 3.1 | 5akp:A, 5akp:B, 7l59:A, 6ndo:A, 6ndo:B, 6ndp:A, 6ndp:B, 6pl0:A, 5uyr:A, 5uyr:B |
4 | 7e0l:A | 491 | 42 | 0.2545 | 0.0285 | 0.3333 | 5.5 | 7e0l:B, 7e0l:K, 7e0l:M, 7wsx:A, 7wsx:B |
5 | 8fru:p | 93 | 42 | 0.2545 | 0.1505 | 0.3333 | 8.1 | 8br8:Lq, 8brm:Lq, 8bsi:Lq, 8bsj:Lq, 8btd:Lq, 8btr:Lq, 7pwg:p, 7pwo:p2 |
6 | 1yk5:A | 53 | 28 | 0.1636 | 0.1698 | 0.3214 | 8.3 | 2pya:A, 1yk4:A, 1yk5:B, 1yk5:C, 1yk5:D |
7 | 3j79:R | 252 | 23 | 0.1818 | 0.0397 | 0.4348 | 9.0 | 3jbn:AR, 3jbo:AR, 3jbp:AR, 8tpu:AR, 5umd:R |
8 | 6k0w:B | 499 | 22 | 0.1455 | 0.0160 | 0.3636 | 9.2 |