Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PGSMVSKSIVEERLRSMLSPQFLKVTDNSGGCGAAFNAYIVSQQFEGKGLLDRQRLVNSAIAAEMPQIHAFTMKCLTPGE
WEAKNR

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 3o2e:A 86 86 1.0000 1.0000 1.0000 1.11e-61
2 3tr3:B 81 53 0.2558 0.2716 0.4151 6.75e-08 3tr3:A
3 1e6y:F 247 76 0.2791 0.0972 0.3158 0.036 1e6y:C, 8gf5:E
4 3adr:A 259 45 0.1744 0.0579 0.3333 0.40 3adr:B
5 8ity:4 365 62 0.1977 0.0466 0.2742 2.1 8iue:4, 8iuh:4
6 7zwc:c 303 62 0.1977 0.0561 0.2742 2.6 7zwd:c, 7zx7:c, 7zx8:c, 7zxe:c
7 6egr:A 396 59 0.1628 0.0354 0.2373 3.0 5d5s:A, 5e4z:A, 4hf8:A, 3jw9:A, 3jwa:A, 3jwb:A, 5k30:A, 5m3z:A, 3mkj:A, 4oma:A, 6s0c:A
8 7xn4:B 422 41 0.1860 0.0379 0.3902 3.2 7xn5:B, 7xn6:B
9 3h1s:B 192 52 0.1628 0.0729 0.2692 6.9 3h1s:A
10 1g7s:A 576 21 0.1047 0.0156 0.4286 7.1 1g7t:A
11 6lqs:BE 823 42 0.1628 0.0170 0.3333 9.6 7d63:BE, 6lqr:BE, 6lqt:BE, 6lqv:BE, 6nd4:T

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218