PGPPLFNVSLDVAPELRWLPVLRHYDVELVRAAVAQVIGDRVPKWVLALIEKGALKLERLLPPPFTAEIRGMCDFLNLSL
ADGLLVNLAYEYSAF
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6dxz:A | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 1.39e-64 | 6dy0:A, 6dy1:A |
2 | 6dxx:A | 97 | 95 | 0.7789 | 0.7629 | 0.7789 | 1.28e-48 | 6dxx:C, 6dxx:E |
3 | 5u84:B | 353 | 101 | 0.2842 | 0.0765 | 0.2673 | 0.003 | 5u84:A |
4 | 5u81:A | 369 | 94 | 0.2316 | 0.0596 | 0.2340 | 0.045 | |
5 | 4u3e:A | 637 | 46 | 0.1789 | 0.0267 | 0.3696 | 0.078 | 4coi:A, 4coi:B, 4coj:A, 4coj:B, 4col:A, 4col:B, 4com:A, 4com:B, 4u3e:B |
6 | 3dbx:A | 279 | 38 | 0.1263 | 0.0430 | 0.3158 | 0.71 | |
7 | 8hbf:A | 522 | 17 | 0.1053 | 0.0192 | 0.5882 | 1.5 | 7d9r:A, 7d9s:A, 7d9u:A, 8hbh:A, 6jt2:A |
8 | 6oon:A | 785 | 45 | 0.1474 | 0.0178 | 0.3111 | 4.4 |