PGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIR
GSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDICPGTN
CPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHF
QDWRCVNFSFCQDLHHKCKNCHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCP
The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7sl6:A | 819 | 298 | 0.9730 | 0.3516 | 0.9664 | 0.0 | 7mqs:F, 7mqs:E, 7sl1:A, 7sl1:B, 7sl2:A, 7sl2:B, 7sl6:B, 7sl7:A, 7sl7:B |
2 | 7yq5:E | 799 | 301 | 0.9899 | 0.3667 | 0.9734 | 0.0 | 7pg0:A, 7pg2:A, 7pg3:A, 7pg4:A, 7sl4:B, 7yq6:E, 7yq6:F |
3 | 8guy:F | 835 | 301 | 0.9899 | 0.3509 | 0.9734 | 0.0 | 6ce7:P, 6ce9:M, 6ce9:P, 6ceb:M, 6ceb:P, 8guy:E, 6hn5:E, 5j3h:E, 7kd6:E, 7kd6:K, 7kd6:Q, 7kd6:W, 5kqv:E, 5kqv:F, 7mqo:F, 7mqo:E, 7mqr:E, 7mqr:F, 4oga:E, 7pg0:B, 7pg2:B, 7pg3:B, 7pg4:B, 7qid:C, 7sl3:A, 7sl3:B, 6sof:A, 6sof:C, 7u6e:F, 7u6e:E, 6vep:E, 6vep:K, 6vep:Q, 6vep:W, 6veq:K, 6veq:E, 3w11:E, 3w12:E, 3w13:E, 4xss:E, 4xst:E, 7yq3:F, 7yq3:E, 7yq4:E, 7yq4:F, 7yq5:F |
4 | 7md4:B | 778 | 296 | 0.9628 | 0.3663 | 0.9628 | 0.0 | |
5 | 7sl4:A | 786 | 298 | 0.9189 | 0.3461 | 0.9128 | 0.0 | 8dtm:B |
6 | 7md4:A | 724 | 288 | 0.8209 | 0.3356 | 0.8438 | 3.58e-169 | |
7 | 6jk8:B | 801 | 297 | 0.5777 | 0.2135 | 0.5758 | 1.46e-113 | |
8 | 6jk8:B | 801 | 119 | 0.0980 | 0.0362 | 0.2437 | 1.5 | |
9 | 6jk8:A | 823 | 297 | 0.5709 | 0.2053 | 0.5690 | 6.86e-109 | 1igr:A, 7v3p:B |
10 | 6jk8:A | 823 | 119 | 0.0980 | 0.0352 | 0.2437 | 1.0 | 1igr:A, 7v3p:B |
11 | 8cls:B | 853 | 294 | 0.4054 | 0.1407 | 0.4082 | 5.20e-63 | |
12 | 8cls:A | 837 | 291 | 0.3953 | 0.1398 | 0.4021 | 1.50e-60 | |
13 | 8u4j:B | 600 | 333 | 0.3649 | 0.1800 | 0.3243 | 6.99e-29 | |
14 | 8u4j:B | 600 | 303 | 0.1993 | 0.0983 | 0.1947 | 2.58e-10 | |
15 | 5xwd:A | 611 | 327 | 0.3007 | 0.1457 | 0.2722 | 1.03e-18 | |
16 | 5xwd:A | 611 | 318 | 0.2669 | 0.1293 | 0.2484 | 7.12e-14 | |
17 | 6btm:B | 948 | 50 | 0.0507 | 0.0158 | 0.3000 | 0.28 | |
18 | 9b4h:A | 1908 | 83 | 0.0845 | 0.0131 | 0.3012 | 1.2 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
19 | 9b4h:A | 1908 | 37 | 0.0473 | 0.0073 | 0.3784 | 3.9 | 9b4h:B, 8wa2:A, 8wa2:D, 8wa2:F, 8wa2:B, 8wa2:C, 8wa2:E |
20 | 4h7u:A | 577 | 27 | 0.0372 | 0.0191 | 0.4074 | 7.2 | |
21 | 8hw1:A | 241 | 40 | 0.0473 | 0.0581 | 0.3500 | 9.4 | 8hw1:K, 8hw1:B, 8hw1:C, 8hw1:D, 8hw1:E, 8hw1:F, 8hw1:G, 8hw1:H, 8hw1:I, 8hw1:J |