PELANKLDPNAKEIDEPVLKAATAAKEEDGKYFDKDGHPTFHITNDGKKVDWFTYSGYRRYHAECHVCHGPDGMGSTYAP
ALKDSLKRLSYEEFYGILAGGKQENQVMPAFGDNKNVMCYANDLYVYLRARAAGAWGRARPGEKEDKPESAKTVEKECL
The query sequence (length=159) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6onq:A | 159 | 159 | 1.0000 | 1.0000 | 1.0000 | 4.73e-119 | |
2 | 7w2j:C | 418 | 106 | 0.1950 | 0.0742 | 0.2925 | 0.079 | 8jej:C, 8jek:C, 8k6j:C, 8k6k:C, 7w2j:F, 7wsq:C, 7wsq:F, 8xcm:C, 8xcn:C |
3 | 8snh:G | 304 | 73 | 0.1384 | 0.0724 | 0.3014 | 0.30 | |
4 | 8snh:G | 304 | 70 | 0.1321 | 0.0691 | 0.3000 | 9.3 | |
5 | 8smr:G | 312 | 60 | 0.1258 | 0.0641 | 0.3333 | 0.69 | |
6 | 1kv9:A | 664 | 59 | 0.1132 | 0.0271 | 0.3051 | 0.70 | |
7 | 8gy2:A | 723 | 45 | 0.0881 | 0.0194 | 0.3111 | 1.2 | |
8 | 5djq:C | 303 | 28 | 0.0755 | 0.0396 | 0.4286 | 2.0 | 5djq:M, 5djq:F, 5djq:I, 3mk7:C, 3mk7:M, 3mk7:F, 3mk7:I |
9 | 8yts:A | 83 | 27 | 0.0629 | 0.1205 | 0.3704 | 2.6 | 8yts:B |
10 | 3dmi:A | 87 | 91 | 0.1509 | 0.2759 | 0.2637 | 3.2 | |
11 | 5xdh:A | 86 | 18 | 0.0566 | 0.1047 | 0.5000 | 4.2 | 5xdh:B, 5xdh:C, 5xdh:D |
12 | 4j20:A | 88 | 66 | 0.1132 | 0.2045 | 0.2727 | 4.7 | 4j20:B |
13 | 5mq6:A | 636 | 70 | 0.1384 | 0.0346 | 0.3143 | 4.7 | |
14 | 5uam:A | 440 | 108 | 0.1447 | 0.0523 | 0.2130 | 5.4 | 5uam:B, 5uas:A, 5uas:B |
15 | 6f0k:E | 182 | 72 | 0.1321 | 0.1154 | 0.2917 | 5.7 | |
16 | 6lod:E | 157 | 56 | 0.1069 | 0.1083 | 0.3036 | 6.3 | 6loe:E |
17 | 5exk:A | 306 | 53 | 0.1132 | 0.0588 | 0.3396 | 7.1 | 5exi:A, 5exj:A, 5exk:C, 5exk:E, 5exk:G, 5exk:I, 5exk:K |
18 | 6p63:C | 595 | 113 | 0.1635 | 0.0437 | 0.2301 | 8.6 | 6p63:A, 6p63:B, 6p63:D, 6xrc:A, 6xrc:B |