PEIYRGVSTLDEPSAAWGWHGLKRNTIQLAGWISVLFMLGYNFGNHKGHVETIWLLVITALLVIGLLIHLFEPKLSQVRT
ITSRNKPVGHVEPDWTYDQATLTGTWGNLTDSQLRSVNIEPSRVAHLRA
The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7qhm:I | 135 | 129 | 1.0000 | 0.9556 | 1.0000 | 9.98e-93 | 7q21:H, 7q21:h, 7qhm:V, 7qho:I, 7qho:V |
2 | 6adq:D | 92 | 69 | 0.2093 | 0.2935 | 0.3913 | 2.39e-08 | 6adq:P, 8ovc:P, 8ovc:I, 8ovd:P, 8ovd:I, 7rh5:P, 7rh5:J, 7rh6:J, 7rh6:P, 7rh7:P, 7rh7:J |
3 | 1ofd:A | 1491 | 37 | 0.1085 | 0.0094 | 0.3784 | 5.5 | 1ofd:B, 1ofe:A, 1ofe:B |
4 | 5ve5:A | 350 | 58 | 0.1240 | 0.0457 | 0.2759 | 6.0 | 5ve3:B, 5ve3:A, 5ve4:A, 5ve4:B, 5ve4:C, 5ve5:B, 5ve5:C |
5 | 4oy6:A | 186 | 15 | 0.0698 | 0.0484 | 0.6000 | 6.4 | 4oy8:A |
6 | 8tun:C | 258 | 27 | 0.0930 | 0.0465 | 0.4444 | 8.7 | 8tt3:C, 8tt3:D, 8tun:D |