PEFMDTCFFCGAVDLSDSSSMRYETLSAKVPSSQKTVSLVLTHLANCIQTQLDLKPGARLCPRCFQELSDYDTIMVNLMT
TQKRLTTQLKLD
The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7poh:B | 92 | 92 | 1.0000 | 1.0000 | 1.0000 | 1.29e-64 | 7poh:A |
2 | 7o7g:A | 627 | 52 | 0.1630 | 0.0239 | 0.2885 | 0.27 | 4lm8:A, 8qbq:A, 8qbz:A, 8qc9:A, 7qth:A |
3 | 7sa4:8 | 203 | 61 | 0.2283 | 0.1034 | 0.3443 | 0.53 | |
4 | 2drp:D | 65 | 52 | 0.1630 | 0.2308 | 0.2885 | 0.86 | 2drp:A |
5 | 6u05:A | 413 | 49 | 0.1630 | 0.0363 | 0.3061 | 2.5 | 6tzm:A, 6tzo:A, 6tzx:A, 6u00:B, 6u03:A, 5u32:A |
6 | 5aaz:A | 31 | 19 | 0.0870 | 0.2581 | 0.4211 | 3.0 | |
7 | 8a3t:U | 114 | 60 | 0.1957 | 0.1579 | 0.3000 | 3.1 | 8a5y:U |
8 | 5f4b:A | 173 | 24 | 0.0978 | 0.0520 | 0.3750 | 5.0 | 5f4b:B |
9 | 7oik:A | 4426 | 24 | 0.1304 | 0.0027 | 0.5000 | 5.3 | 7oim:A, 6tax:A, 6tay:A |
10 | 2xrg:A | 758 | 26 | 0.1087 | 0.0132 | 0.3846 | 5.5 | |
11 | 3way:A | 787 | 26 | 0.1087 | 0.0127 | 0.3846 | 5.5 | 8c3o:B, 8c3p:A, 8c3p:B, 8c4w:A, 8c7r:A, 5dlv:A, 5dlv:B, 5dlw:A, 5inh:A, 5l0b:A, 5l0b:B, 5l0e:A, 5l0e:B, 5l0k:A, 5l0k:B, 6leh:A, 5lqq:A, 5m0d:A, 5m0e:A, 5m0m:A, 5m0s:A, 7mfh:A, 5mhp:A, 3nkn:A, 3nko:A, 3nkq:A, 3nkr:A, 5ohi:A, 5olb:A, 7p0k:AAA, 7p4j:A, 7p4o:A, 3waw:A, 6y5m:A, 4zg7:A |
12 | 5s9m:A | 809 | 26 | 0.1087 | 0.0124 | 0.3846 | 5.5 | 8c3o:A, 5dlt:A, 9ent:A, 9eu5:A, 5hrt:A, 5ijq:A, 5ijs:A, 5lia:A, 3nkm:A, 3nkp:A, 5s9l:A, 5s9n:A, 6w35:A, 3wav:A, 3wax:A, 2xr9:A, 7z0n:AAA, 7z3k:AAA, 7z3l:AAA |
13 | 5b0s:B | 355 | 42 | 0.1304 | 0.0338 | 0.2857 | 9.6 | 5b0q:A, 5b0q:B, 5b0r:A, 5b0r:B, 5b0s:A |
14 | 1wog:A | 303 | 18 | 0.0978 | 0.0297 | 0.5000 | 9.8 | 1wog:B, 1wog:C, 1wog:D, 1wog:E, 1wog:F, 1woi:A, 1woi:B, 1woi:C, 1woi:D, 1woi:E, 1woi:F |