BioLiP

>protein
PDNFTAAAQDLAQSLDANTVTFPANISSMPEFRNWAKGKIDLDSDSIGWYFKYLDPAGATESARAVGEYSKIPDGLVKFS
VDAEIREIYNEECPVVTDVSVPLDGRQWSLSIFSFPMFRTAYVAVANVENKEMSLDVVNDLIEWLNNLADWRYVVDSEQW
INFTNDTTYYVRIRVLRPTYDVPDPTEGLVRTVSDYRLTYKAITCEANMPTLVDQGFWIGGQYALTPTSLPQYDVSEAYA
LHTLTFARPSSAAALAFVWAGLPQGGTAPAGTPAWEQASSGGYLTWRHNGTTFPAGSVSYVLPEGFALERYDPNDGSWTD
FASAGDTVTFRQVAVDEVVVTNNPAGGGSAPTFTVRVPPSNAYTNTVFRNTLLETRPSSRRLELPMPPADFGQTVANNPK
IEQSLLKETLGCYLVHSKMRNPVFQLTPASSFGAVSFNNPGYERTRDLPDYTGIRDSFDQNMSTAVAHFRSLSHSCSIVT
KTYQGWEGVTNVNTPFGQFAHAGLLKNEEILCLADDLATRLTGVYPATDN

The query sequence (length=530) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3s6p:C	536	530	1.0000	0.9888	1.0000	0.0	3s6p:B
2	1ohf:C	590	531	0.6698	0.6017	0.6685	0.0	7anm:A, 7anm:B, 7anm:C, 1ohf:A, 1ohf:B, 1ohf:D
3	7xpg:A	463	211	0.0792	0.0907	0.1991	0.036	7xpg:B, 7xpg:C
4	3euj:A	437	88	0.0434	0.0526	0.2614	0.20
5	6sga:CH	222	55	0.0358	0.0856	0.3455	0.84	7pua:CH, 6sgb:CH
6	6j9f:C	1296	102	0.0509	0.0208	0.2647	3.2
7	6j9e:C	1288	102	0.0509	0.0210	0.2647	3.5
8	4nxv:C	337	81	0.0472	0.0742	0.3086	5.3	4nxu:A, 4nxu:B, 4nxu:C, 4nxu:D, 4nxv:A, 4nxv:B, 4nxv:D, 4nxw:A, 4nxx:A, 4oag:A, 4oag:B
9	2c03:B	297	68	0.0358	0.0640	0.2794	8.1	2c03:A, 2cnw:A, 2cnw:B, 2cnw:C, 2j7p:A, 2j7p:B, 1jpj:A, 1jpn:B, 1jpn:A, 1ls1:A, 1ng1:A, 2ng1:A, 1o87:A, 1o87:B, 1okk:A
10	4r5e:A	343	34	0.0283	0.0437	0.4412	8.2
11	4eqb:A	323	72	0.0340	0.0557	0.2500	8.5	4eqb:B

[Back]