BioLiP

>protein
PDMKRSLRLMKKEEKSKKLEVPLAKRQQDRLMREAAYKKTNETLDRWIETVKHNRRAEHLVFPLAQNAHDRGLDASELQP
ITQKTSGTELEQTILAIMEESDYKLKDVIINEKRVKKNDKYLATGLPHPFESQQQYERSLRLPVGPEWMTKETFQDATKP
RVIIKQGIIAPMSKPMY

The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6rxu:UN	177	177	1.0000	1.0000	1.0000	5.49e-131	5oql:K, 6rxt:UN, 6rxv:UN, 6rxy:UN, 6rxz:UN
2	7ajt:UN	147	154	0.3446	0.4150	0.3961	2.22e-33	6zqa:UN, 6zqb:UN, 6zqc:UN
3	6ke6:RQ	226	214	0.3898	0.3053	0.3224	3.18e-30	7d5s:RQ, 6lqp:RQ, 6lqq:RQ, 6lqr:RQ, 6lqs:RQ, 6lqt:RQ, 6lqu:RQ, 6lqv:RQ
4	7suk:SS	197	201	0.3446	0.3096	0.3035	1.25e-25	5wlc:SS
5	7d5t:RQ	339	75	0.2090	0.1091	0.4933	9.63e-19
6	7d5t:RQ	339	89	0.1808	0.0944	0.3596	3.41e-10
7	7d4i:RQ	339	75	0.2090	0.1091	0.4933	1.32e-18
8	7d4i:RQ	339	89	0.1808	0.0944	0.3596	4.33e-10
9	7d63:RQ	275	72	0.1751	0.1127	0.4306	5.86e-14
10	7d63:RQ	275	89	0.1808	0.1164	0.3596	2.54e-10
11	7mqa:SS	350	72	0.1695	0.0857	0.4167	2.98e-11
12	7mqa:SS	350	92	0.1977	0.1000	0.3804	4.41e-08
13	6gzd:A	297	40	0.0734	0.0438	0.3250	5.0	5fqd:C, 5fqd:F, 8g66:C
14	8pv6:CR	516	23	0.0678	0.0233	0.5217	5.2	8pv8:CR
15	8pv4:CR	390	23	0.0678	0.0308	0.5217	5.5
16	6ynv:e	417	52	0.0904	0.0384	0.3077	6.7	6ynx:e, 6ynx:E, 6yny:e, 6yny:E, 6ynz:e, 6ynz:E, 6ynz:e3, 6ynz:E3

[Back]