BioLiP

>protein
PAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLA
KDDQLKVHGF

The query sequence (length=90) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a09:Z	110	90	1.0000	0.8182	1.0000	8.91e-63	9bln:W, 4kzx:l, 4kzy:l, 8pj1:p, 8ppk:p, 8ppl:Ip, 7qp6:p, 8xxn:C1, 6ybw:p, 6zmw:p, 6zp4:Z, 6zvj:N
2	6gsm:m	96	90	0.5889	0.5521	0.5889	1.27e-36	8cah:m, 6gsn:m, 3j80:j, 3j81:m, 3jam:j, 3jap:m, 4uer:F, 6zce:m
3	8s8f:m	77	87	0.4778	0.5584	0.4943	7.66e-26	8s8i:m
4	4bts:AF	89	83	0.4444	0.4494	0.4819	3.49e-24	4bts:BF, 4bts:CF, 4bts:DF, 4v5o:AF, 4v5o:BF
5	7ase:V	97	83	0.3667	0.3402	0.3976	5.58e-21
6	5jb3:1	83	82	0.3222	0.3494	0.3537	3.44e-07	5jbh:1
7	5zcy:A	83	76	0.2667	0.2892	0.3158	3.42e-05
8	3pgx:A	270	74	0.2333	0.0778	0.2838	0.83	3pgx:B, 3pgx:C, 3pgx:D
9	8xr6:Q	143	70	0.1778	0.1119	0.2286	1.3	8xr6:q
10	4hjw:C	378	40	0.1333	0.0317	0.3000	2.6	4hjw:A, 4hjw:B
11	2vs1:A	398	43	0.1333	0.0302	0.2791	4.0	2jjq:A
12	8pdv:A	1027	29	0.1444	0.0127	0.4483	5.5	8pd8:A, 8pd8:B, 8pd9:A, 8pdu:A, 8pdu:B
13	8xq7:A	1041	29	0.1444	0.0125	0.4483	5.5	8xq7:B
14	8otq:A	1051	29	0.1444	0.0124	0.4483	5.5	8otq:B, 8otw:B, 8xq8:A
15	1zt2:A	327	67	0.2111	0.0581	0.2836	6.7	5of3:A, 5of3:D, 5ofn:A, 1zt2:C
16	5hyc:A	130	49	0.1333	0.0923	0.2449	7.7
17	4zyj:D	392	16	0.1111	0.0255	0.6250	8.1	4zyj:A, 4zyj:B, 4zyj:C
18	8jxu:A	1410	28	0.1111	0.0071	0.3571	8.1	8jxq:A

[Back]