Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
PADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGKPVAAPHTHPVDELYLLVSPNKGGARIEVQL
DGRRHELLSPAVMRIPAGSEHCFLTLEAEVGSYCFGILLGDRL

The query sequence (length=123) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6j4b:A 123 123 1.0000 1.0000 1.0000 1.21e-85 6j4c:A, 6jtf:A
2 7eqk:A 119 119 0.8374 0.8655 0.8655 3.14e-70 7eqk:B, 7eu6:A, 7eu6:B, 7eue:A, 7eue:B, 7eup:A, 7eup:B, 7euz:A, 7euz:B, 7f6x:A, 7f6x:B
3 2h0v:A 335 29 0.0976 0.0358 0.4138 0.77 2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B
4 5ya6:B 165 72 0.1463 0.1091 0.2500 1.4 5ya6:A
5 5nqz:A 267 47 0.1301 0.0599 0.3404 3.2 5nqz:B
6 4mlc:A 336 33 0.1138 0.0417 0.4242 4.7 4q6b:A
7 8hku:L30E 94 39 0.1220 0.1596 0.3846 8.0 8hkv:L30E, 8hky:L30E, 8hkz:L30E, 8hl1:L30E, 8hl2:L30E, 8hl3:L30E, 8hl4:L30E, 8hl5:L30E
8 6iiv:A 461 21 0.0894 0.0239 0.5238 8.3 1b13:A, 1b2j:A, 1b2o:A, 1b2o:B, 1be7:A, 1bfy:A, 1c09:A, 1c09:B, 1c09:C, 1fhh:A, 1fhm:A, 6iiu:A, 1irn:A, 1iro:A, 1r0h:A, 4rxn:A, 5rxn:A, 1smm:A, 1smu:A, 1smw:A, 1t9o:A, 1t9o:B, 1t9o:C, 1t9p:A, 1t9p:B, 1t9p:C, 1t9q:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218