BioLiP

>protein
NYTEELKVPPDEDCIICMEKLSTASGYSDVTDSKALGSLAVGHLTKCSHAFHLLCLLAMYCNGNKDGSLQCPSCKT

The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6y2x:A	231	76	0.9737	0.3203	0.9737	3.74e-48	6ir0:A, 6y22:A, 6y3j:A
2	1v87:A	114	76	0.8684	0.5789	0.8684	1.18e-45
3	6y5p:B	229	74	0.6053	0.2009	0.6216	3.43e-30	6y5n:A, 6y5n:B, 6y5p:A
4	6y2x:B	177	66	0.6974	0.2994	0.8030	1.67e-22
5	8i3x:A	60	65	0.2368	0.3000	0.2769	0.004	8i3x:B
6	1f62:A	51	31	0.1974	0.2941	0.4839	0.044
7	7xyz:B	456	30	0.1447	0.0241	0.3667	0.044	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
8	7jzv:A	253	31	0.1842	0.0553	0.4516	0.092	8grq:K, 1jm7:A, 7lyb:M
9	7xga:A	126	31	0.1579	0.0952	0.3871	0.74	6vfo:A
10	6a3z:A	56	72	0.2895	0.3929	0.3056	0.91
11	5a31:B	84	71	0.2632	0.2381	0.2817	2.1	5g04:B, 5g05:B, 9gaw:C, 5jg6:A, 5jg6:D, 2mt5:A, 7qe7:C, 4r2y:A, 4r2y:B, 4r2y:C, 4r2y:D, 8s4g:C, 6tm5:B, 6tnt:B, 4ui9:B
12	2ecw:A	85	31	0.1579	0.1412	0.3871	3.0
13	5vab:A	54	29	0.1711	0.2407	0.4483	4.5
14	3aln:A	270	46	0.1842	0.0519	0.3043	9.5	3aln:B
15	3alo:A	289	46	0.1842	0.0484	0.3043	9.6
16	5ech:A	569	68	0.2368	0.0316	0.2647	9.6	5ech:D, 5eci:A, 5eci:D, 5eck:A, 5eck:D, 5ecl:A, 5ecl:D, 5ecm:A, 5ecm:D, 5ecn:A, 5ecn:D, 5eco:A, 5eco:D, 5ecp:A, 5ecp:D, 5ecq:A, 5ecq:D, 5ecr:A, 5ecr:D, 4epl:A, 5gzz:A

[Back]