NYKEKLQQYAELLVKVGMNVQPKQPVFIRSSVETLELTHLIVEEAYHCGASDVRVVYSDPTLKRLKFENESVEHFANHEI
The query sequence (length=413) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
1zjc:A |
413 |
413 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
|
2 |
4icq:A |
413 |
413 |
0.4794 |
0.4794 |
0.4794 |
2.45e-131 |
4icq:B, 4icr:A, 4icr:B, 4ics:A, 4ics:B |
3 |
2ayi:A |
397 |
408 |
0.3753 |
0.3904 |
0.3799 |
9.29e-98 |
2ayi:B, 2ayi:C, 2ayi:D, 2ayi:E |
4 |
2io4:B |
246 |
225 |
0.1211 |
0.2033 |
0.2222 |
0.13 |
2io4:D |
5 |
7bl2:9P1 |
338 |
33 |
0.0412 |
0.0503 |
0.5152 |
0.24 |
7bl3:9P, 7bl4:9, 7bl5:9, 7bl6:9, 4csu:9, 5m04:A |
6 |
3wgy:B |
324 |
79 |
0.0605 |
0.0772 |
0.3165 |
1.1 |
3wgq:A, 3wgz:B |
7 |
4lc9:A |
567 |
33 |
0.0291 |
0.0212 |
0.3636 |
1.3 |
|
8 |
2faq:A |
295 |
108 |
0.0508 |
0.0712 |
0.1944 |
3.3 |
2faq:B, 2far:A, 2far:B |
9 |
5jxf:A |
694 |
80 |
0.0508 |
0.0303 |
0.2625 |
3.3 |
5jxf:B |
10 |
4pfy:A |
539 |
20 |
0.0315 |
0.0241 |
0.6500 |
4.2 |
4pft:A, 4pft:B, 4pfy:B |
11 |
8hsg:I |
1096 |
53 |
0.0363 |
0.0137 |
0.2830 |
4.7 |
3aoi:C, 3aoi:H, 3aoi:M, 4gzy:C, 4gzz:C |
12 |
2a68:C |
1119 |
53 |
0.0363 |
0.0134 |
0.2830 |
4.7 |
2a68:M, 2a69:C, 2a69:M, 2a6h:C, 2a6h:M, 3aoh:C, 2be5:C, 2be5:M, 6cuu:C, 5d4c:C, 5d4c:M, 5d4d:C, 5d4d:M, 5d4e:C, 5d4e:M, 3dxj:C, 3dxj:M, 5e17:C, 5e18:C, 7eh0:C, 7eh1:C, 7eh2:C, 7eh2:M, 3eql:C, 3eql:M, 4g7h:C, 4g7h:M, 4g7o:C, 4g7o:M, 4g7z:C, 4g7z:M, 8hsr:I, 5i2d:C, 5i2d:N, 1i6v:C, 1iw7:C, 1iw7:M, 6kqd:C, 6kqd:M, 6kqe:C, 6kqf:C, 6kqg:C, 6kqh:C, 6kql:C, 6kqm:C, 6kqn:C, 6l74:C, 6lts:C, 6m6a:C, 6m6c:C, 7mlb:C, 7mli:C, 7mlj:C, 4mq9:C, 2o5i:C, 2o5i:M, 2o5j:C, 2o5j:M, 4oin:C, 4oio:C, 4oip:C, 4oiq:C, 4oir:C, 6ovr:C, 6ovy:C, 6ow3:C, 6oy5:C, 6oy6:C, 6oy7:C, 6p70:C, 6p71:C, 2ppb:C, 2ppb:M, 4q4z:C, 4q5s:C, 7rdq:C, 1smy:C, 1smy:M, 5tmc:C, 5tmf:C, 5vo8:C, 5voi:C, 8w8n:C, 8w8o:C, 8w8p:C, 6wox:C, 6woy:C, 4wqs:C, 4wqs:M, 5x21:C, 5x22:C, 5x22:M, 4xln:C, 4xln:I, 4xlr:C, 4xlr:I, 1ynj:C, 1ynn:C, 1zyr:C, 1zyr:M |
13 |
4bb9:A |
596 |
33 |
0.0266 |
0.0185 |
0.3333 |
9.5 |
4bba:A, 4ly9:A, 4ly9:B, 4mqu:A, 4mqu:B, 4mro:A, 4mro:B, 4msu:A, 4msu:B, 4ohk:A, 4ohk:B, 4ohm:A, 4ohm:B, 4oho:A, 4oho:B, 4ohp:A, 4ohp:B, 4olh:A, 4olh:B, 4op1:A, 4op1:B, 4op2:A, 4op2:B, 4op3:A, 4op3:B, 4px2:A, 4px2:B, 4px3:A, 4px3:B, 4px5:A, 4px5:B, 4pxs:A, 4pxs:B |
14 |
1nf2:A |
267 |
75 |
0.0508 |
0.0787 |
0.2800 |
9.8 |
1nf2:B, 1nf2:C |