BioLiP

>protein
NTYQEFTNIDQAKAWGNAQYKKYGLSKSEKEAIVSYTKSASEINGKLRQNKGVINGFPSNLIKQVELLDKSFNKMKTPEN
IMLFRGDDPAYLGTEFQNTLLNSNGTINKTAFEKAKAKFLNKDRLEYGYISTSLMNVSQFAGRPIITKFKVAKGSKAGYI
DPISAFAGQLEMLLPRHSTYHIDDMRLSSDGKQIIITATMMG

The query sequence (length=202) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1gzf:B	211	202	1.0000	0.9573	1.0000	1.40e-150	2a9k:B, 2c8a:A, 2c8a:B, 2c8a:C, 2c8a:D, 2c8c:A, 2c8c:D, 2c8c:B, 2c8c:C, 2c8f:E, 2c8h:A, 2c8h:B, 1gzf:A, 1gzf:C, 1gzf:D, 1uzi:A, 1uzi:B
2	5bwm:B	205	207	0.3861	0.3805	0.3768	1.04e-39	4xsh:B
3	5dzq:O	184	173	0.3564	0.3913	0.4162	6.31e-39	5dzq:A
4	1ojz:A	212	204	0.3663	0.3491	0.3627	3.34e-33
5	1qs2:A	401	198	0.2871	0.1446	0.2929	5.70e-18
6	1qs2:A	401	150	0.1832	0.0923	0.2467	0.019
7	4fxq:A	445	204	0.2772	0.1258	0.2745	3.10e-15	4fk7:A, 4fxq:B
8	6x6x:A	417	201	0.2624	0.1271	0.2637	9.38e-13	2wn6:A, 2wn7:A, 6x6r:A, 6x6r:B, 6x6v:A, 6x6v:B, 6x6v:C, 6x6v:D, 6x6x:B
9	4h03:A	414	202	0.2624	0.1280	0.2624	5.72e-11	3buz:A, 1giq:A, 1giq:B, 1gir:A, 4h0t:A, 4h0v:A, 4h0x:A, 4h0y:A
10	5wtz:A	420	202	0.2525	0.1214	0.2525	2.77e-09	5h04:A, 5wu0:A
11	4fxc:A	98	30	0.0495	0.1020	0.3333	1.5
12	4uap:A	150	75	0.1188	0.1600	0.3200	1.6	4uap:B
13	5hma:A	191	37	0.0644	0.0681	0.3514	4.7	5hm9:A
14	2b3x:A	888	63	0.0842	0.0191	0.2698	9.1	2b3y:A, 2b3y:B

[Back]