NTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGKDLSPRWYFYYLGTGPEAGLPYGANKDGII
WVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFY
The query sequence (length=121) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7acs:A | 140 | 125 | 1.0000 | 0.8643 | 0.9680 | 3.51e-85 | 7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D |
2 | 6wkp:A | 103 | 119 | 0.8430 | 0.9903 | 0.8571 | 4.05e-67 | |
3 | 6lz8:B | 130 | 124 | 0.6033 | 0.5615 | 0.5887 | 5.92e-46 | 6kl5:A, 6kl6:B |
4 | 6lz8:D | 112 | 120 | 0.5537 | 0.5982 | 0.5583 | 1.53e-40 | 7dyd:D, 6kl5:C, 6kl6:D, 6lnn:D, 6lz6:D |
5 | 4kxj:A | 135 | 124 | 0.4711 | 0.4222 | 0.4597 | 2.20e-28 | 4li4:A, 4lm7:A, 4lm9:A, 4lmc:A, 4lmt:A |
6 | 4fe2:B | 235 | 52 | 0.1488 | 0.0766 | 0.3462 | 0.32 | 4fe2:A, 4fgr:A, 4fgr:B, 4nye:A, 4nye:B |
7 | 3lya:A | 318 | 34 | 0.1157 | 0.0440 | 0.4118 | 2.1 | |
8 | 6o62:A | 169 | 82 | 0.1736 | 0.1243 | 0.2561 | 7.7 | |
9 | 6omp:A | 356 | 78 | 0.1818 | 0.0618 | 0.2821 | 8.3 | 6omp:B, 6omq:A, 6omq:B, 6omr:A, 6omr:B |
10 | 4zs9:B | 378 | 42 | 0.0992 | 0.0317 | 0.2857 | 9.6 | 4zs9:A, 4zza:A, 4zza:B, 4zze:A, 4zze:B |