NSIIVSPRQRGNPVLKFVRNVPWEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDP
QQALKELAKMCILADCTLILAWSPEEAGRYLETYKA
The query sequence (length=116) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6sxb:G | 191 | 115 | 0.9914 | 0.6021 | 1.0000 | 1.46e-83 | 2jnw:A |
2 | 3ai2:A | 263 | 29 | 0.1121 | 0.0494 | 0.4483 | 0.85 | 3ai2:B, 3ai2:H, 3ai2:D, 3ai2:E, 3ai2:C, 3ai2:F, 3ai2:G, 3ai3:A, 3ai3:C, 3ai3:E, 3ai3:G |
3 | 1j04:A | 387 | 51 | 0.1552 | 0.0465 | 0.3529 | 1.2 | 4cbr:A, 4cbs:A, 5f9s:A, 5f9s:B, 1h0c:A, 5hhy:A, 5hhy:B, 5luc:A, 5luc:B, 5luc:E, 5luc:G, 5luc:M, 5luc:N, 5luc:S, 5luc:T, 5ofy:A, 5og0:A, 6rv0:A, 6rv1:A, 2yob:A, 2yob:B |
4 | 8dzr:A | 258 | 70 | 0.1466 | 0.0659 | 0.2429 | 1.6 | |
5 | 5xte:J | 378 | 54 | 0.1207 | 0.0370 | 0.2593 | 2.3 | 5xte:V, 5xth:AJ, 5xth:AV, 5xti:AJ, 5xti:AV |
6 | 4djh:B | 448 | 70 | 0.1466 | 0.0379 | 0.2429 | 4.2 | 4djh:A |
7 | 8eup:x | 306 | 40 | 0.1207 | 0.0458 | 0.3500 | 4.4 | 8esq:x, 8eth:x, 8eti:x, 8euy:x, 8ev3:x |
8 | 4g3h:C | 310 | 49 | 0.1207 | 0.0452 | 0.2857 | 5.3 | 4g3h:A, 4g3h:B, 4g3h:D |
9 | 4qdk:A | 219 | 85 | 0.1897 | 0.1005 | 0.2588 | 7.2 | 4qdj:A, 4qdk:B |
10 | 1w6j:A | 727 | 47 | 0.1293 | 0.0206 | 0.3191 | 7.3 | 1w6k:A |
11 | 2nx9:B | 453 | 62 | 0.1724 | 0.0442 | 0.3226 | 7.4 | 2nx9:A |
12 | 3s3s:A | 620 | 11 | 0.0603 | 0.0113 | 0.6364 | 8.1 | 3s3p:A |
13 | 2q3z:A | 655 | 11 | 0.0603 | 0.0107 | 0.6364 | 8.2 | 9bc2:A, 3s3j:A |
14 | 4pyg:A | 685 | 11 | 0.0603 | 0.0102 | 0.6364 | 8.3 | 6a8p:A, 6a8p:B, 6a8p:C, 9bc3:A, 9bc3:B, 9bc4:A, 1kv3:A, 1kv3:B, 1kv3:C, 1kv3:D, 1kv3:E, 1kv3:F, 6kzb:A, 6kzb:B, 3ly6:A, 3ly6:B, 3ly6:C, 4pyg:B, 4pyg:E, 8tr9:A |
15 | 6kzb:C | 649 | 11 | 0.0603 | 0.0108 | 0.6364 | 8.6 | |
16 | 1gm5:A | 729 | 69 | 0.1724 | 0.0274 | 0.2899 | 9.5 |