NSCNFNNSIKNVIVFYINEKALIEEKKMLSCYENKLLNLIKEDCENIMLKYKPNLSYICSLLKVDDTSEENIKHIKDQII
ESLENDNRPSVKLAIISLISMIVEMNGYKGKNIPMSFLIEDIALKISENSEDLINFINIKNK
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6tqp:A | 142 | 142 | 1.0000 | 1.0000 | 1.0000 | 4.88e-95 | 6tqq:A, 6trr:A |
2 | 4uf2:A | 136 | 134 | 0.3451 | 0.3603 | 0.3657 | 3.47e-18 | 4uf1:A, 4uf3:A |
3 | 6xy6:C | 138 | 109 | 0.2746 | 0.2826 | 0.3578 | 1.25e-06 | 6xy4:A, 6xy6:A, 6xy6:E, 6xy6:G, 6xy6:I, 6xy6:K, 6xy6:M, 6xy6:O |
4 | 2jby:A | 127 | 137 | 0.2606 | 0.2913 | 0.2701 | 0.40 | |
5 | 8ewg:A | 1017 | 65 | 0.0986 | 0.0138 | 0.2154 | 3.7 | |
6 | 8rd8:Cl | 272 | 88 | 0.1479 | 0.0772 | 0.2386 | 7.9 | 8rdv:Cl, 8rdw:Cl |