NQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGIRSSTNDPR
RKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMP
The query sequence (length=129) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 8yzs:A | 133 | 129 | 1.0000 | 0.9699 | 1.0000 | 7.92e-97 | 8yzs:B |
| 2 | 4ix7:A | 114 | 81 | 0.1705 | 0.1930 | 0.2716 | 0.25 | 4ix7:B |
| 3 | 6s20:C | 480 | 20 | 0.0930 | 0.0250 | 0.6000 | 1.1 | |
| 4 | 1y56:B | 374 | 39 | 0.1008 | 0.0348 | 0.3333 | 1.1 | |
| 5 | 8hki:q | 338 | 39 | 0.0930 | 0.0355 | 0.3077 | 5.0 | |
| 6 | 5o6c:A | 252 | 72 | 0.1395 | 0.0714 | 0.2500 | 5.1 | 6t7f:A |
| 7 | 4i3x:A | 476 | 31 | 0.1008 | 0.0273 | 0.4194 | 7.1 | 4i3t:A, 4i3t:B, 4i3t:C, 4i3t:D, 4i3t:E, 4i3t:F, 4i3t:G, 4i3t:H, 4i3u:A, 4i3u:B, 4i3u:C, 4i3u:D, 4i3u:E, 4i3u:F, 4i3u:G, 4i3u:H, 4i3v:A, 4i3v:B, 4i3v:C, 4i3v:D, 4i3v:E, 4i3v:F, 4i3v:G, 4i3v:H, 4i3w:A, 4i3w:B, 4i3w:C, 4i3w:D, 4i3w:E, 4i3w:F, 4i3w:G, 4i3w:H, 4i3x:B, 4i3x:C, 4i3x:D, 4i3x:E, 4i3x:F, 4i3x:G, 4i3x:H |
| 8 | 4cyd:B | 225 | 23 | 0.0620 | 0.0356 | 0.3478 | 7.1 | 4cyd:A, 4cyd:C, 4cyd:D, 3r6s:A, 3r6s:B, 3r6s:C, 3r6s:D, 3r6s:E, 3r6s:F |
| 9 | 1esm:A | 311 | 78 | 0.1550 | 0.0643 | 0.2564 | 9.1 | 1esm:B, 1esm:C, 1esm:D, 1esn:A, 1esn:B, 1esn:C, 1esn:D, 4f7w:A, 4f7w:C, 4f7w:B, 4f7w:D, 4f7w:E, 4f7w:F, 4f7w:G, 4f7w:H, 4gi7:A, 4gi7:C, 4gi7:B, 4gi7:D, 4gi7:E, 4gi7:F, 4gi7:G, 4gi7:H, 4ne2:A, 4ne2:B, 1sq5:A, 1sq5:B, 1sq5:C, 1sq5:D |
umich.edu