NPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLKPVATGNQDLKDGGFAFPPTN
PLISPMTLNGMRDFYKNNEYVKNLDELTLCSRHAGNMNPDNDKSNYKYPAVYDYNDKKCHILYIAAQENNGPRYCNSMFC
FRPAKDKLFENYTYLSKNVVDNWEEVCPRKNLENAKFGLWVDGNCEDIPHVNEFSANDLFECNKLVFELSASDQPKQYYE
KIKEGFKNKNASMIKSAFLPTGADRYKSHGKGYNWGNYNRETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE
The query sequence (length=314) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6n87:A | 314 | 314 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3srj:A | 298 | 315 | 0.8408 | 0.8859 | 0.8381 | 0.0 | 3sri:A, 3srj:B, 4z09:A, 4z0d:A, 4z0e:A, 4z0f:A |
3 | 6n7q:A | 266 | 314 | 0.8439 | 0.9962 | 0.8439 | 0.0 | |
4 | 4apm:A | 339 | 311 | 0.3471 | 0.3215 | 0.3505 | 1.22e-50 | |
5 | 4yiv:A | 374 | 339 | 0.3089 | 0.2594 | 0.2861 | 4.95e-32 | |
6 | 6nzu:A | 402 | 119 | 0.0987 | 0.0771 | 0.2605 | 0.025 | 6nzu:E, 8pk8:A, 8pk9:A, 8pka:A, 7rtk:A, 8tvt:A, 6uxe:A, 6w1d:A, 6wi2:A, 6wih:A, 5wkp:A, 5wkp:E, 5wlw:A, 5wlw:E |
7 | 5wgb:A | 291 | 113 | 0.0987 | 0.1065 | 0.2743 | 0.027 | |
8 | 4l63:A | 249 | 107 | 0.0892 | 0.1124 | 0.2617 | 1.5 | 4l6t:A |
9 | 3cei:A | 213 | 18 | 0.0350 | 0.0516 | 0.6111 | 1.7 | 3cei:B |
10 | 5ldr:A | 731 | 58 | 0.0446 | 0.0192 | 0.2414 | 3.5 | 5ldr:B |
11 | 7bvs:A | 290 | 37 | 0.0318 | 0.0345 | 0.2703 | 8.7 | 7exb:A |