BioLiP

>protein
NPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPNSFRLEKILVS
VGCTCVTPIVH

The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8uss:A	107	91	0.9670	0.8224	0.9670	8.58e-61
2	5vb9:A	108	90	0.9341	0.7870	0.9444	1.68e-58	7ama:A, 7ama:B, 7amg:A, 7amg:B, 7amg:C, 7amg:D, 8cdg:A, 8cdg:B, 8dyf:A, 8dyf:B, 8dyg:A, 8dyg:B, 8dyh:A, 8dyh:B, 8dyi:A, 8dyi:B, 5hhv:A, 5hhx:A, 5hi3:A, 5hi3:B, 5hi4:A, 5hi4:B, 5hi5:A, 5hi5:B, 8usr:A, 8usr:B, 8usr:D, 5vb9:B
3	3jvf:B	104	88	0.5824	0.5096	0.6023	5.12e-32
4	6z1p:AR	274	76	0.2527	0.0839	0.3026	0.80
5	8opp:A	670	37	0.1209	0.0164	0.2973	1.0
6	8opt:A	783	37	0.1209	0.0140	0.2973	1.2	8ops:A, 5w0m:B, 5w0n:C, 5w0o:A, 5w0o:B
7	8htu:H	95	18	0.0879	0.0842	0.4444	2.6	7ksq:H, 7kux:H, 6l35:H, 7xqp:H
8	8tr2:A	745	21	0.1099	0.0134	0.4762	5.1	2e4u:A, 2e4u:B, 2e4v:A, 2e4v:B, 2e4w:A, 2e4w:B, 2e4x:A, 2e4x:B, 2e4y:A, 2e4y:B, 8tqb:A, 8tqb:B, 8tr0:B, 8tr2:B, 8trc:A, 8trc:B, 8trd:A, 8trd:B, 7wi6:A, 7wi6:B, 7wi8:A, 7wi8:B
9	5by6:B	288	44	0.1319	0.0417	0.2727	5.5	5by6:A, 5by6:C, 5by6:D, 5m4z:A, 5m4z:B
10	8jjm:A	484	43	0.1538	0.0289	0.3256	6.1	8jjm:B
11	8jcu:3	765	20	0.1099	0.0131	0.5000	6.5	6b7h:A, 5cnk:A, 5cnm:A, 8jcv:3, 8jcw:3, 8jcx:3, 8jcy:3, 8jcz:3, 8jd0:3, 8jd1:3, 8jd2:3, 8jd3:3, 3sm9:A, 8tr0:A, 7wih:A, 7wih:B, 4xar:A
12	4pu5:A	438	20	0.0989	0.0205	0.4500	7.5
13	6wb7:A	296	52	0.1648	0.0507	0.2885	8.2	6wb7:B, 6wb7:C, 6wb7:D

[Back]