NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
The query sequence (length=38) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1fav:A | 78 | 38 | 1.0000 | 0.4872 | 1.0000 | 7.05e-21 | 6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D |
| 2 | 6x5b:B | 149 | 38 | 0.8947 | 0.2282 | 0.8947 | 2.24e-18 | 6x5b:E, 6x5b:K, 6x5c:B, 6x5c:G, 6x5c:F |
| 3 | 6pwu:A | 615 | 38 | 0.8947 | 0.0553 | 0.8947 | 8.62e-18 | 6j5e:I, 6ulc:C, 6ulc:A, 3vtp:C, 5yb2:E, 5yb2:F, 5yb2:D, 5yb2:A, 5yb2:B, 5yb2:C, 5yb2:M, 5yb3:E, 5yb3:F, 5yb3:D, 5yc0:A, 5yc0:D, 5yc0:E, 5z0w:E, 5zcx:A, 5zpw:A, 5zpw:E, 5zpw:C |
| 4 | 7n6u:B | 595 | 38 | 0.8947 | 0.0571 | 0.8947 | 1.92e-17 | 5fuu:A, 5fuu:D, 5fuu:E, 5fuu:F, 6j5e:K, 7n6u:C, 7n6u:A, 7n6w:A, 7n6w:B, 7n6w:C, 6olp:C, 7ska:B, 7ska:O, 7ska:Z, 6vpx:C, 5y14:C, 5y14:A, 5y14:B, 5yc0:B, 5yc0:C, 5yc0:F |
| 5 | 2kp8:A | 72 | 32 | 0.8421 | 0.4444 | 1.0000 | 4.82e-16 | 2kp8:B |
| 6 | 7ucf:B | 137 | 38 | 0.7368 | 0.2044 | 0.7368 | 4.01e-11 | 5t3x:B, 7t75:B, 7t9a:D, 7t9b:D, 7t9b:F |
| 7 | 6opn:B | 124 | 25 | 0.5789 | 0.1774 | 0.8800 | 6.37e-10 | 6opn:E, 6opn:H |
| 8 | 6ohy:B | 120 | 23 | 0.5263 | 0.1667 | 0.8696 | 1.59e-08 | 6ohy:E, 6ohy:F |
| 9 | 1czq:A | 45 | 19 | 0.4474 | 0.3778 | 0.8947 | 1.76e-05 | 1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B |
| 10 | 1rm6:B | 323 | 36 | 0.2632 | 0.0310 | 0.2778 | 9.0 | 1rm6:E, 1sb3:B, 1sb3:E |
umich.edu