BioLiP

>protein
NMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6ycs:C	68	66	1.0000	0.9706	1.0000	3.66e-44	2c62:A, 2c62:B, 2phe:A, 2phe:B, 4usg:A, 4usg:B, 6ycs:A, 6ycs:B, 6ycs:D
2	5zg9:A	83	63	0.3636	0.2892	0.3810	6.41e-08	4bhm:A, 4bhm:D, 4bhm:B, 4bhm:F, 4bhm:C
3	6s3t:A	374	39	0.1515	0.0267	0.2564	1.9	6rux:A, 6rux:B, 6rux:C, 6s3t:B, 6s3t:S, 6s3t:T
4	3r0q:G	353	51	0.2273	0.0425	0.2941	2.1	3r0q:C, 3r0q:A, 3r0q:E
5	5f55:A	705	20	0.1364	0.0128	0.4500	2.5	5f54:A, 5f56:A, 6lrd:A
6	1sza:B	140	44	0.1818	0.0857	0.2727	2.8	2bf0:X
7	8tg3:A	187	27	0.1364	0.0481	0.3333	3.6	8tg4:A
8	3lxd:A	409	28	0.1515	0.0244	0.3571	4.3
9	6fwf:A	712	31	0.1364	0.0126	0.2903	5.4
10	6l1x:A	708	31	0.1364	0.0127	0.2903	5.4
11	6l3h:A	741	31	0.1364	0.0121	0.2903	5.7	6l3h:B
12	1ddz:A	481	21	0.1364	0.0187	0.4286	6.0	1ddz:B
13	3c0g:B	320	23	0.1364	0.0281	0.3913	7.3	3c0g:A, 3c0h:A, 3c0h:B, 3c0i:A, 3mfr:A, 3mfs:A, 3mfu:A, 7oai:A, 7oai:B, 7oai:C, 7oai:D, 7oaj:A, 7oaj:B, 7oaj:C, 7oaj:D, 7oak:A, 7oak:B, 7oak:C, 7oak:D, 7oal:A, 7oal:B, 7oal:C, 7oal:D
14	1dii:A	515	17	0.1364	0.0175	0.5294	8.5	1dii:B, 1diq:A, 1diq:B, 1wve:A, 1wve:B, 1wvf:A
15	4x36:A	318	29	0.1667	0.0346	0.3793	8.7	2bml:B, 5ctv:A, 1h8g:A, 1h8g:B, 1hcx:A, 1hcx:B, 4ivv:A, 4iwt:A, 4iwt:B
16	7a26:CCC	348	26	0.1364	0.0259	0.3462	9.3	7a26:FFF, 7a26:GGG, 7a26:HHH

[Back]