NLKVEFYNSNPSDTTNSINPQFKVTNTGSSAIDLSKLTLRYYYTVDGQKDQTFWCDHAAIIGSNGSYNGITSNVKGTFVK
MSSSTNNADTYLEISFTGGTLEPGAHVQIQGRFAKNDWSNYTQSNDYSFKSASQFVEWDQVTAYLNGVLVWG
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4jo5:A | 170 | 152 | 1.0000 | 0.8941 | 1.0000 | 3.57e-111 | 4b9f:A, 4b9f:B, 1nbc:A, 1nbc:B |
2 | 3zqw:A | 153 | 155 | 0.5395 | 0.5359 | 0.5290 | 1.91e-50 | 3zu8:A, 3zuc:A |
3 | 1g43:A | 160 | 154 | 0.4671 | 0.4437 | 0.4610 | 1.19e-43 | |
4 | 4b97:A | 151 | 154 | 0.4539 | 0.4570 | 0.4481 | 1.48e-39 | |
5 | 6d5b:B | 154 | 155 | 0.5000 | 0.4935 | 0.4903 | 3.25e-39 | 6d5b:A, 6d5b:C, 6d5b:D, 6d5b:E, 6d5b:F, 6d5b:G, 6d5b:H, 6d5b:I, 6d5b:J, 6d5b:K, 6d5b:L |
6 | 6sl4:A | 150 | 154 | 0.4276 | 0.4333 | 0.4221 | 5.99e-39 | 6sl4:B, 6sl4:C |
7 | 4b9c:A | 150 | 151 | 0.3553 | 0.3600 | 0.3576 | 2.92e-29 | |
8 | 4b9p:A | 166 | 166 | 0.3947 | 0.3614 | 0.3614 | 1.93e-28 | |
9 | 4b96:A | 151 | 152 | 0.3355 | 0.3377 | 0.3355 | 1.31e-19 | |
10 | 2wo4:A | 159 | 148 | 0.3355 | 0.3208 | 0.3446 | 1.43e-18 | 2wnx:A, 2wob:A, 2wob:C, 2wob:E |
11 | 3zqx:A | 146 | 154 | 0.3289 | 0.3425 | 0.3247 | 1.39e-15 | |
12 | 3ff1:B | 444 | 64 | 0.1250 | 0.0428 | 0.2969 | 2.8 | |
13 | 5yu6:C | 1073 | 49 | 0.0855 | 0.0121 | 0.2653 | 6.1 | 3a6p:A, 3a6p:F, 5yu6:A |